BLASTX nr result
ID: Catharanthus22_contig00008261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00008261 (201 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342960.1| PREDICTED: mitochondrial import inner membra... 55 1e-05 >ref|XP_006342960.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Solanum tuberosum] Length = 191 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/44 (63%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = -2 Query: 131 MAYQP-RVPNFNDDGNNDSERVRLYNPYQDLKVPVQTLYKLPTS 3 MAYQ + PN D N+D + RLYNPYQDL+VP++TLYKLPTS Sbjct: 1 MAYQQHQSPNHTGD-NDDGKNRRLYNPYQDLQVPIKTLYKLPTS 43