BLASTX nr result
ID: Catharanthus22_contig00007819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00007819 (420 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY29035.1| DNA-directed RNA polymerase II subunit rpb4, puta... 59 9e-07 >gb|EOY29035.1| DNA-directed RNA polymerase II subunit rpb4, putative isoform 1 [Theobroma cacao] gi|508781780|gb|EOY29036.1| DNA-directed RNA polymerase II subunit rpb4, putative isoform 1 [Theobroma cacao] Length = 231 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 418 MISNIQVESVDEVFALVPSLEGKKLRLTEPLKDMLDELAKVKSS 287 +I+N E+VDEVFALV SLE KK RL+EPLKD+LDEL K+K S Sbjct: 187 VIANTCPETVDEVFALVRSLEAKKSRLSEPLKDVLDELGKLKKS 230