BLASTX nr result
ID: Catharanthus22_contig00007646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00007646 (225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62334.1| Leucine-rich repeat-containing protein 48 [Morus ... 60 2e-07 >gb|EXB62334.1| Leucine-rich repeat-containing protein 48 [Morus notabilis] Length = 690 Score = 60.5 bits (145), Expect = 2e-07 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = -1 Query: 225 GCDWKSEDM-GRNVIDCDMSLSNTVHPMKKCQSLGSGLDRKVRESGENASECEIEQQFSC 49 G WKSEDM + VID D+ + + + +KK QSLGSGL R+ R S +N E E +Q SC Sbjct: 73 GRGWKSEDMKNKFVIDSDLLIPHRGN-LKKSQSLGSGLYREGRVSADNDFEEETDQGLSC 131 Query: 48 DGSHDNSGSHGPNGAK 1 DGS D +G +G+K Sbjct: 132 DGSQDRNGFGARDGSK 147