BLASTX nr result
ID: Catharanthus22_contig00007000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00007000 (1340 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ02729.1| hypothetical protein PRUPE_ppa016152mg, partial [... 48 2e-06 gb|EMJ22510.1| hypothetical protein PRUPE_ppa025777mg, partial [... 46 3e-06 gb|EMJ14584.1| hypothetical protein PRUPE_ppa026473mg [Prunus pe... 46 3e-06 >gb|EMJ02729.1| hypothetical protein PRUPE_ppa016152mg, partial [Prunus persica] Length = 613 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 22/47 (46%), Positives = 34/47 (72%), Gaps = 3/47 (6%) Frame = -3 Query: 255 EFENFESQYGIASSKS---QVYLDEALMPRGARLNVLDYWKSNKYKW 124 EF+NFES+ S++ Q+YLDEA + R +LNVLD+WK N++++ Sbjct: 472 EFDNFESEEFTTSAQKTQLQLYLDEAKIDRKTKLNVLDFWKVNQFRY 518 Score = 32.0 bits (71), Expect(2) = 2e-06 Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = -1 Query: 92 SFPITTIALEFAFS---RILNPYQSKILPKNVE 3 S PI+T+A E FS R+L+ Y+S + P+NVE Sbjct: 530 SIPISTVASESTFSVDGRVLDQYRSALKPENVE 562 >gb|EMJ22510.1| hypothetical protein PRUPE_ppa025777mg, partial [Prunus persica] Length = 697 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 21/47 (44%), Positives = 33/47 (70%), Gaps = 3/47 (6%) Frame = -3 Query: 255 EFENFESQYGIASSKS---QVYLDEALMPRGARLNVLDYWKSNKYKW 124 EF+NFES+ S++ Q+YLDE + R +LNVLD+WK N++++ Sbjct: 556 EFDNFESEEFTTSAQKTQLQLYLDEPKIDRKTKLNVLDFWKVNQFRY 602 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 3/33 (9%) Frame = -1 Query: 92 SFPITTIALEFAFS---RILNPYQSKILPKNVE 3 S PI+T+A E AFS R+L+ Y+S + P+NVE Sbjct: 614 SIPISTVASESAFSVGGRVLDQYRSALKPENVE 646 >gb|EMJ14584.1| hypothetical protein PRUPE_ppa026473mg [Prunus persica] Length = 696 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 21/47 (44%), Positives = 33/47 (70%), Gaps = 3/47 (6%) Frame = -3 Query: 255 EFENFESQYGIASSKS---QVYLDEALMPRGARLNVLDYWKSNKYKW 124 EF+NFES+ S++ Q+YLDE + R +LNVLD+WK N++++ Sbjct: 555 EFDNFESEEFTTSAQKTQLQLYLDEPKIDRKTKLNVLDFWKVNQFRY 601 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 3/33 (9%) Frame = -1 Query: 92 SFPITTIALEFAFS---RILNPYQSKILPKNVE 3 S PI+T+A E AFS R+L+ Y+S + P+NVE Sbjct: 613 SIPISTVASESAFSVGGRVLDQYRSALKPENVE 645