BLASTX nr result
ID: Catharanthus22_contig00005934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00005934 (1039 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_006737703.1| hypothetical protein, partial [Lactobacillus... 58 5e-06 >ref|WP_006737703.1| hypothetical protein, partial [Lactobacillus iners] gi|325477781|gb|EGC80917.1| hypothetical protein HMPREF0523_1106 [Lactobacillus iners UPII 60-B] Length = 156 Score = 58.2 bits (139), Expect = 5e-06 Identities = 23/51 (45%), Positives = 27/51 (52%) Frame = -2 Query: 888 WNWSRFWFWRWLWIWGRMGFWRHAFEFSGTRCRWRLWSWLRPWMGIWHRVW 736 W W RFWFW WLW+W + W F F RLW WL W +W R+W Sbjct: 63 WFWFRFWFWLWLWLWLWLWLW---FWF-------RLWLWLWLWFRLWFRLW 103