BLASTX nr result
ID: Catharanthus22_contig00005252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00005252 (1456 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004333678.1| ubiquitin thiolesterase [Acanthamoeba castel... 53 9e-06 >ref|XP_004333678.1| ubiquitin thiolesterase [Acanthamoeba castellanii str. Neff] gi|440790382|gb|ELR11665.1| ubiquitin thiolesterase [Acanthamoeba castellanii str. Neff] Length = 1978 Score = 52.8 bits (125), Expect(2) = 9e-06 Identities = 42/125 (33%), Positives = 58/125 (46%), Gaps = 2/125 (1%) Frame = +1 Query: 922 PSFILSPTPPPSQSVHLFNFPSSMHNPTPISPPLVSEDSQPFQT-SPLTAPTTLPHSLKS 1098 PS SPTP PS + N PS + P+P + P S P T SP ++P+ P S + Sbjct: 1451 PSSTNSPTPSPSNTPSPSNTPSPSNTPSPSNTPSPSNTPSPSSTHSPTSSPSNTP-SPSN 1509 Query: 1099 LPALIGTSLGHNHPPPRSPKLSASPFPSAKSLPY-SDNGSPLNSGRNNQPSSLSLVRTPL 1275 P+ T N P SP + SP PS + P S+ SP N+ + + S TP Sbjct: 1510 TPSPSNTPSPSNTP---SPSSTNSPTPSPSNTPSPSNTPSPSNTPSPSNTPTPSPSNTPS 1566 Query: 1276 PAIYP 1290 P+ P Sbjct: 1567 PSNTP 1571 Score = 25.0 bits (53), Expect(2) = 9e-06 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 1340 SNSPSTSAWYAPSPNSSGCSYP*P 1411 SN+PS S+ +P+P+SS P P Sbjct: 1608 SNTPSPSSTSSPTPSSSNTPTPSP 1631