BLASTX nr result
ID: Catharanthus22_contig00004334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00004334 (755 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331047.1| predicted protein [Populus trichocarpa] gi|5... 59 2e-06 >ref|XP_002331047.1| predicted protein [Populus trichocarpa] gi|566174707|ref|XP_006381063.1| hypothetical protein POPTR_0006s05890g [Populus trichocarpa] gi|550335566|gb|ERP58860.1| hypothetical protein POPTR_0006s05890g [Populus trichocarpa] Length = 104 Score = 58.9 bits (141), Expect = 2e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +3 Query: 42 RRLSSSVTKQSTHHWLPSIHEDYYGPKIHNPRHH 143 +RLS SV+K+S+HHW P IHEDY GP+ H PRHH Sbjct: 71 KRLSRSVSKKSSHHWSPRIHEDYCGPRHHKPRHH 104