BLASTX nr result
ID: Catharanthus22_contig00004303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00004303 (1881 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173482.1| hypothetical protein NitaMp145 [Nicotiana tabac... 65 1e-07 ref|YP_006291826.1| orf42 gene product (mitochondrion) [Daucus c... 60 3e-06 >ref|YP_173482.1| hypothetical protein NitaMp145 [Nicotiana tabacum] gi|56806647|dbj|BAD83548.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 103 Score = 64.7 bits (156), Expect = 1e-07 Identities = 42/101 (41%), Positives = 51/101 (50%), Gaps = 15/101 (14%) Frame = +2 Query: 20 MVHCLFIVLAQEPKRTRLYLLYWTFAVERSPVLPCTDHI*IHIDSFFVPGPASQL----- 184 MVH LFIVLA+EPKRTRL P+ H I ++ PA+ + Sbjct: 1 MVHRLFIVLAREPKRTRLLPTVLDLRPGILPLSNRNQHHCIALEQLSGRRPATSVHRYRF 60 Query: 185 ----------FAGW*RSKPCLVRQNWIKKRECSTGTTANKM 277 G RS+ CLVR+NW KKRECSTGTTAN + Sbjct: 61 ILRTWSSLTTLRGLVRSQSCLVRRNWTKKRECSTGTTANNV 101 >ref|YP_006291826.1| orf42 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081988|gb|AEY81180.1| orf42 (mitochondrion) [Daucus carota subsp. sativus] Length = 133 Score = 60.1 bits (144), Expect = 3e-06 Identities = 45/103 (43%), Positives = 56/103 (54%), Gaps = 18/103 (17%) Frame = +2 Query: 20 MVHCLFIVLAQEPKRTR--LYLLYWT--------------FAVER-SPVLPCTDHI*IHI 148 MVHCLF LA++PK+ YLLYWT A+E+ S P T +H Sbjct: 1 MVHCLF--LARKPKQNEHACYLLYWTPDQALYLCRIGTNTTALEQLSGRRPATS---VHR 55 Query: 149 DSFFVPGPAS-QLFAGW*RSKPCLVRQNWIKKRECSTGTTANK 274 F + +S G RS+ CLVR+NW KK+ECSTGTTANK Sbjct: 56 YRFILHTWSSLTTLRGLVRSQSCLVRRNWAKKKECSTGTTANK 98