BLASTX nr result
ID: Catharanthus22_contig00004153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00004153 (395 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339815.1| PREDICTED: LOB domain-containing protein 37-... 56 4e-06 >ref|XP_006339815.1| PREDICTED: LOB domain-containing protein 37-like [Solanum tuberosum] Length = 212 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -3 Query: 375 LADLDLSLTPGFQSKLNDVVSNPFYVK-RRIGSPSLNSEESVTTTCFES 232 LADLDLSLTPGF K+ + S+P RR G+PS+NSEES TTTCFES Sbjct: 151 LADLDLSLTPGFNQKVYN--SHPLPENHRRPGTPSMNSEESGTTTCFES 197