BLASTX nr result
ID: Catharanthus22_contig00003820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00003820 (489 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ16351.1| cytokinesis negative regulator RCP1 [Nicotiana ta... 67 7e-15 ref|XP_002271062.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 62 6e-08 ref|XP_006339950.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 61 2e-07 ref|XP_004248833.1| PREDICTED: E3 ubiquitin-protein ligase RING1... 57 3e-06 >gb|ABJ16351.1| cytokinesis negative regulator RCP1 [Nicotiana tabacum] Length = 302 Score = 66.6 bits (161), Expect(2) = 7e-15 Identities = 44/90 (48%), Positives = 54/90 (60%), Gaps = 8/90 (8%) Frame = +1 Query: 244 FPFQP-----FDDTISLPLPYAAQ---SDDNFLLDSPYLQRLIQHLMTSNNNSNGTSPIP 399 FP QP +D IS L A SDDNFLLDSPYL RLI HL T+N+ +PIP Sbjct: 60 FPNQPDSNPNLEDLISTDLNTATNFTPSDDNFLLDSPYLHRLIHHLTTAND-----APIP 114 Query: 400 PPHFNSPASKSAIESLAHVKIDVEFLQKDP 489 +SPASK+A+E+L +KI L+ DP Sbjct: 115 NRQ-HSPASKAAMEALEGIKISSLMLENDP 143 Score = 39.3 bits (90), Expect(2) = 7e-15 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +3 Query: 102 HHQTYWCHECDMSVLLQPRSTTTFP 176 HH T+WCHECDMSV L +T P Sbjct: 12 HHHTFWCHECDMSVFLLHLPSTDPP 36 >ref|XP_002271062.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Vitis vinifera] Length = 312 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 7/68 (10%) Frame = +1 Query: 307 DNFLLDSPYLQRLIQHL---MTSNNNSNGTSPIPPPHFNSP----ASKSAIESLAHVKID 465 +NFLLDSPYL RLI HL +NN+ N +S +PPP + +P AS++++E+L KI Sbjct: 78 ENFLLDSPYLHRLIHHLTHPSDTNNDGNDSSDLPPPRYLNPNSVAASRASLEALPTFKIT 137 Query: 466 VEFLQKDP 489 FLQ DP Sbjct: 138 PSFLQLDP 145 >ref|XP_006339950.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum tuberosum] Length = 291 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/63 (52%), Positives = 44/63 (69%) Frame = +1 Query: 301 SDDNFLLDSPYLQRLIQHLMTSNNNSNGTSPIPPPHFNSPASKSAIESLAHVKIDVEFLQ 480 SDDNFLL+SPYL RLI+HL T+N+ +P P PH NS AS+SA+ +L ++I L+ Sbjct: 77 SDDNFLLNSPYLHRLIRHLTTTND-----APTPNPHNNS-ASRSAVAALELLQITSSMLE 130 Query: 481 KDP 489 DP Sbjct: 131 NDP 133 >ref|XP_004248833.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Solanum lycopersicum] Length = 291 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/63 (50%), Positives = 43/63 (68%) Frame = +1 Query: 301 SDDNFLLDSPYLQRLIQHLMTSNNNSNGTSPIPPPHFNSPASKSAIESLAHVKIDVEFLQ 480 SDDNFLL+SPYL RLI+HL T+N+ +P P H NS AS+SA+ +L ++I L+ Sbjct: 77 SDDNFLLNSPYLHRLIRHLTTTND-----APTPNLHNNS-ASRSAVAALELLQITSSMLE 130 Query: 481 KDP 489 DP Sbjct: 131 NDP 133