BLASTX nr result
ID: Catharanthus22_contig00003485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00003485 (418 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citr... 59 5e-07 ref|XP_004245808.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 >ref|XP_006422261.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] gi|568881878|ref|XP_006493776.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Citrus sinensis] gi|557524134|gb|ESR35501.1| hypothetical protein CICLE_v10004323mg [Citrus clementina] Length = 827 Score = 59.3 bits (142), Expect = 5e-07 Identities = 37/87 (42%), Positives = 50/87 (57%), Gaps = 4/87 (4%) Frame = -3 Query: 251 LLIIPYDMHFISAPS-LSKTLVSTSLFQ*GKRQSWYSPNDEFYITLFLDILNESRDNVSH 75 L +P +H A ++ + S SLF+ KRQSWY P DE Y+ LF D+LNESRD Sbjct: 158 LQFVPKMVHITQALKVINDSDTSLSLFRWAKRQSWYVPGDECYVMLF-DVLNESRDFDGM 216 Query: 74 SLMIRFLI---GENSLSYFSPYNRVIQ 3 + ++ +N +S FS YNRVIQ Sbjct: 217 LSLFDEMVHDSSKNGISLFSAYNRVIQ 243 >ref|XP_004245808.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79490, mitochondrial-like [Solanum lycopersicum] Length = 794 Score = 56.6 bits (135), Expect = 3e-06 Identities = 40/88 (45%), Positives = 50/88 (56%), Gaps = 5/88 (5%) Frame = -3 Query: 251 LLIIPYDMHFISAPSLSKTL-VSTSLFQ*GKRQSWYSPNDEFYITLFLDILNESRDNVSH 75 L IP H + A + + S SLF+ KRQ WY PND YITLF D LN+SRD Sbjct: 123 LQFIPNMTHIMQALKVMEDSDASLSLFRWAKRQPWYKPNDACYITLF-DKLNQSRDFDGI 181 Query: 74 SLMIRFLI---GEN-SLSYFSPYNRVIQ 3 L+ ++ GEN + S F+ YNRVIQ Sbjct: 182 QLVFDDMVLDSGENGASSLFNAYNRVIQ 209