BLASTX nr result
ID: Catharanthus22_contig00003412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00003412 (382 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283422.1| PREDICTED: brain protein 44-like protein iso... 57 3e-06 gb|EXC51644.1| hypothetical protein L484_000871 [Morus notabilis] 55 1e-05 >ref|XP_002283422.1| PREDICTED: brain protein 44-like protein isoform 1 [Vitis vinifera] gi|359491059|ref|XP_003634213.1| PREDICTED: brain protein 44-like protein isoform 2 [Vitis vinifera] gi|147768423|emb|CAN75662.1| hypothetical protein VITISV_007924 [Vitis vinifera] gi|297734381|emb|CBI15628.3| unnamed protein product [Vitis vinifera] Length = 107 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 380 SNETVQLYQLSRWAKGQGYLHQKEEKAASN 291 SNETVQLYQLSRWAKGQGYL +K+++AASN Sbjct: 78 SNETVQLYQLSRWAKGQGYLQEKKDEAASN 107 >gb|EXC51644.1| hypothetical protein L484_000871 [Morus notabilis] Length = 164 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 380 SNETVQLYQLSRWAKGQGYLHQKEEKAAS 294 SNETVQLYQLSRWAKGQGYL +K+E+AAS Sbjct: 135 SNETVQLYQLSRWAKGQGYLSEKKEEAAS 163