BLASTX nr result
ID: Catharanthus22_contig00003310
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00003310 (220 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ06824.1| hypothetical protein PRUPE_ppa009132mg [Prunus pe... 64 2e-08 ref|XP_002299088.2| PUR alpha-1 family protein [Populus trichoca... 64 3e-08 gb|ESW29823.1| hypothetical protein PHAVU_002G101600g [Phaseolus... 63 3e-08 ref|NP_001241408.1| uncharacterized protein LOC100782805 [Glycin... 63 3e-08 gb|EOY32275.1| Transcription factor Pur-alpha 1 [Theobroma cacao] 63 5e-08 ref|XP_004294929.1| PREDICTED: transcription factor Pur-alpha 1-... 63 5e-08 ref|XP_003529454.1| PREDICTED: transcription factor Pur-alpha 1 ... 63 5e-08 emb|CBI16575.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_002283799.1| PREDICTED: transcription factor Pur-alpha 1-... 63 5e-08 emb|CAN72395.1| hypothetical protein VITISV_041199 [Vitis vinifera] 63 5e-08 ref|XP_004505354.1| PREDICTED: transcription factor Pur-alpha 1-... 62 6e-08 gb|AFK34045.1| unknown [Medicago truncatula] 62 6e-08 ref|XP_003607817.1| Transcription factor Pur-alpha [Medicago tru... 62 6e-08 ref|XP_006368525.1| hypothetical protein POPTR_0001s03780g [Popu... 62 8e-08 ref|XP_002304844.2| hypothetical protein POPTR_0003s20690g [Popu... 62 8e-08 ref|XP_004228968.1| PREDICTED: transcription factor Pur-alpha 1-... 62 8e-08 gb|EXB57380.1| hypothetical protein L484_016433 [Morus notabilis] 62 1e-07 ref|XP_002523383.1| nucleic acid binding protein, putative [Rici... 61 1e-07 ref|XP_006445544.1| hypothetical protein CICLE_v10016090mg [Citr... 61 2e-07 ref|XP_004174050.1| PREDICTED: transcription factor Pur-alpha 1-... 61 2e-07 >gb|EMJ06824.1| hypothetical protein PRUPE_ppa009132mg [Prunus persica] Length = 305 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGSARDEGWAAFRNILAEINEASR+FILPNQ Sbjct: 144 AGSARDEGWAAFRNILAEINEASRLFILPNQ 174 >ref|XP_002299088.2| PUR alpha-1 family protein [Populus trichocarpa] gi|550346450|gb|EEE83893.2| PUR alpha-1 family protein [Populus trichocarpa] Length = 317 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQV 125 AGS+RDEGWAAFRNILAEINEASR+F+LPNQV Sbjct: 154 AGSSRDEGWAAFRNILAEINEASRLFMLPNQV 185 >gb|ESW29823.1| hypothetical protein PHAVU_002G101600g [Phaseolus vulgaris] Length = 284 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRNILAEINEASR+FILPNQ Sbjct: 123 AGSSRDEGWAAFRNILAEINEASRLFILPNQ 153 >ref|NP_001241408.1| uncharacterized protein LOC100782805 [Glycine max] gi|255640975|gb|ACU20767.1| unknown [Glycine max] Length = 286 Score = 63.2 bits (152), Expect = 3e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRNILAEINEASR+FILPNQ Sbjct: 125 AGSSRDEGWAAFRNILAEINEASRLFILPNQ 155 >gb|EOY32275.1| Transcription factor Pur-alpha 1 [Theobroma cacao] Length = 362 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS RDEGWAAFRNILAEINEASR+FILPNQ Sbjct: 144 AGSTRDEGWAAFRNILAEINEASRLFILPNQ 174 >ref|XP_004294929.1| PREDICTED: transcription factor Pur-alpha 1-like [Fragaria vesca subsp. vesca] Length = 289 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS RDEGWAAFRNILAEINEASR+FILPNQ Sbjct: 128 AGSTRDEGWAAFRNILAEINEASRLFILPNQ 158 >ref|XP_003529454.1| PREDICTED: transcription factor Pur-alpha 1 isoform 1 [Glycine max] Length = 283 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRN+LAEINEASR+FILPNQ Sbjct: 122 AGSSRDEGWAAFRNVLAEINEASRLFILPNQ 152 >emb|CBI16575.3| unnamed protein product [Vitis vinifera] Length = 256 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS RDEGWAAFRNILAEINEASR+FILPNQ Sbjct: 95 AGSTRDEGWAAFRNILAEINEASRLFILPNQ 125 >ref|XP_002283799.1| PREDICTED: transcription factor Pur-alpha 1-like [Vitis vinifera] Length = 279 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS RDEGWAAFRNILAEINEASR+FILPNQ Sbjct: 118 AGSTRDEGWAAFRNILAEINEASRLFILPNQ 148 >emb|CAN72395.1| hypothetical protein VITISV_041199 [Vitis vinifera] Length = 291 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS RDEGWAAFRNILAEINEASR+FILPNQ Sbjct: 130 AGSTRDEGWAAFRNILAEINEASRLFILPNQ 160 >ref|XP_004505354.1| PREDICTED: transcription factor Pur-alpha 1-like [Cicer arietinum] Length = 295 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRNILAEINEASR+F+LPNQ Sbjct: 134 AGSSRDEGWAAFRNILAEINEASRLFLLPNQ 164 >gb|AFK34045.1| unknown [Medicago truncatula] Length = 217 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRNILAEINEASR+F+LPNQ Sbjct: 134 AGSSRDEGWAAFRNILAEINEASRLFLLPNQ 164 >ref|XP_003607817.1| Transcription factor Pur-alpha [Medicago truncatula] gi|355508872|gb|AES90014.1| Transcription factor Pur-alpha [Medicago truncatula] Length = 293 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRNILAEINEASR+F+LPNQ Sbjct: 134 AGSSRDEGWAAFRNILAEINEASRLFLLPNQ 164 >ref|XP_006368525.1| hypothetical protein POPTR_0001s03780g [Populus trichocarpa] gi|550346449|gb|ERP65094.1| hypothetical protein POPTR_0001s03780g [Populus trichocarpa] Length = 297 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRNILAEINEASR+F+LPNQ Sbjct: 135 AGSSRDEGWAAFRNILAEINEASRLFMLPNQ 165 >ref|XP_002304844.2| hypothetical protein POPTR_0003s20690g [Populus trichocarpa] gi|550343648|gb|EEE79823.2| hypothetical protein POPTR_0003s20690g [Populus trichocarpa] Length = 302 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRNILAEINEASR+F+LPNQ Sbjct: 141 AGSSRDEGWAAFRNILAEINEASRLFMLPNQ 171 >ref|XP_004228968.1| PREDICTED: transcription factor Pur-alpha 1-like [Solanum lycopersicum] Length = 283 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGSARDEGWAAFRNILAEINEASR+FI PNQ Sbjct: 123 AGSARDEGWAAFRNILAEINEASRLFISPNQ 153 >gb|EXB57380.1| hypothetical protein L484_016433 [Morus notabilis] Length = 298 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS RDEGWAAFRNILAEINEASR+F+LPNQ Sbjct: 137 AGSTRDEGWAAFRNILAEINEASRLFMLPNQ 167 >ref|XP_002523383.1| nucleic acid binding protein, putative [Ricinus communis] gi|223537333|gb|EEF38962.1| nucleic acid binding protein, putative [Ricinus communis] Length = 282 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS RDEGWAAFRNILAEINE SR+FILPNQ Sbjct: 121 AGSTRDEGWAAFRNILAEINETSRLFILPNQ 151 >ref|XP_006445544.1| hypothetical protein CICLE_v10016090mg [Citrus clementina] gi|568871600|ref|XP_006488970.1| PREDICTED: transcription factor Pur-alpha 1-like [Citrus sinensis] gi|557548155|gb|ESR58784.1| hypothetical protein CICLE_v10016090mg [Citrus clementina] Length = 300 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS+RDEGWAAFRNILAEINEASR+ ILPNQ Sbjct: 139 AGSSRDEGWAAFRNILAEINEASRLLILPNQ 169 >ref|XP_004174050.1| PREDICTED: transcription factor Pur-alpha 1-like, partial [Cucumis sativus] Length = 184 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 220 AGSARDEGWAAFRNILAEINEASRIFILPNQ 128 AGS RDEGW+AFRNILAEINEASR+FILPNQ Sbjct: 23 AGSNRDEGWSAFRNILAEINEASRLFILPNQ 53