BLASTX nr result
ID: Catharanthus22_contig00002593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00002593 (266 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001513459.2| PREDICTED: 40S ribosomal protein S15-like [O... 79 8e-13 gb|EXB93222.1| 40S ribosomal protein S15 [Morus notabilis] 77 2e-12 gb|EXB29864.1| 40S ribosomal protein S15 [Morus notabilis] 77 2e-12 ref|XP_006876809.1| PREDICTED: 40S ribosomal protein S15 [Chryso... 77 2e-12 ref|XP_006746009.1| PREDICTED: 40S ribosomal protein S15 [Lepton... 77 2e-12 dbj|BAA01746.1| ribosomal protein S15 [Oryza sativa] 77 2e-12 ref|NP_001009.1| 40S ribosomal protein S15 [Homo sapiens] gi|667... 77 2e-12 gb|EUB58429.1| 40S ribosomal protein S15-B [Echinococcus granulo... 77 2e-12 ref|XP_006650736.1| PREDICTED: 40S ribosomal protein S15-like [O... 77 2e-12 ref|XP_006640013.1| PREDICTED: 40S ribosomal protein S15-like [L... 77 2e-12 ref|XP_006352119.1| PREDICTED: 40S ribosomal protein S15-like [S... 77 2e-12 ref|XP_006350663.1| PREDICTED: 40S ribosomal protein S15-like [S... 77 2e-12 ref|XP_006171827.1| PREDICTED: 40S ribosomal protein S15 [Tupaia... 77 2e-12 gb|ESW32413.1| hypothetical protein PHAVU_002G320200g [Phaseolus... 77 2e-12 gb|ESW26074.1| hypothetical protein PHAVU_003G089200g [Phaseolus... 77 2e-12 gb|ESW16696.1| hypothetical protein PHAVU_007G178000g [Phaseolus... 77 2e-12 ref|XP_006125018.1| PREDICTED: 40S ribosomal protein S15 [Pelodi... 77 2e-12 ref|XP_006443898.1| hypothetical protein CICLE_v10022652mg [Citr... 77 2e-12 ref|XP_006443897.1| hypothetical protein CICLE_v10022652mg [Citr... 77 2e-12 ref|XP_006420117.1| hypothetical protein CICLE_v10006127mg [Citr... 77 2e-12 >ref|XP_001513459.2| PREDICTED: 40S ribosomal protein S15-like [Ornithorhynchus anatinus] Length = 163 Score = 78.6 bits (192), Expect = 8e-13 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK*SILLSFW 132 EMIGHYL EFSITYKPVKHGRPGIGATHSSRFIPLK + L F+ Sbjct: 110 EMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLKKPLPLFFF 153 >gb|EXB93222.1| 40S ribosomal protein S15 [Morus notabilis] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 117 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >gb|EXB29864.1| 40S ribosomal protein S15 [Morus notabilis] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 117 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >ref|XP_006876809.1| PREDICTED: 40S ribosomal protein S15 [Chrysochloris asiatica] Length = 266 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYL EFSITYKPVKHGRPGIGATHSSRFIPLK Sbjct: 231 EMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 266 >ref|XP_006746009.1| PREDICTED: 40S ribosomal protein S15 [Leptonychotes weddellii] Length = 122 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYL EFSITYKPVKHGRPGIGATHSSRFIPLK Sbjct: 87 EMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 122 >dbj|BAA01746.1| ribosomal protein S15 [Oryza sativa] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 117 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >ref|NP_001009.1| 40S ribosomal protein S15 [Homo sapiens] gi|6677799|ref|NP_033117.1| 40S ribosomal protein S15 [Mus musculus] gi|8394212|ref|NP_058847.1| 40S ribosomal protein S15 [Rattus norvegicus] gi|45382615|ref|NP_990793.1| 40S ribosomal protein S15 [Gallus gallus] gi|47523728|ref|NP_999499.1| 40S ribosomal protein S15 [Sus scrofa] gi|197101253|ref|NP_001125055.1| 40S ribosomal protein S15 [Pongo abelii] gi|388454438|ref|NP_001252851.1| 40S ribosomal protein S15 [Macaca mulatta] gi|528078508|ref|NP_001268540.1| 40S ribosomal protein S15 [Mesocricetus auratus] gi|55647825|ref|XP_512237.1| PREDICTED: 40S ribosomal protein S15 isoform 2 [Pan troglodytes] gi|332255848|ref|XP_003277039.1| PREDICTED: 40S ribosomal protein S15 isoform 4 [Nomascus leucogenys] gi|334326695|ref|XP_001373175.2| PREDICTED: 40S ribosomal protein S15-like [Monodelphis domestica] gi|348550393|ref|XP_003461016.1| PREDICTED: 40S ribosomal protein S15 [Cavia porcellus] gi|402891895|ref|XP_003909166.1| PREDICTED: 40S ribosomal protein S15-like isoform 1 [Papio anubis] gi|402891897|ref|XP_003909167.1| PREDICTED: 40S ribosomal protein S15-like isoform 2 [Papio anubis] gi|402903563|ref|XP_003914633.1| PREDICTED: 40S ribosomal protein S15 [Papio anubis] gi|426386455|ref|XP_004059700.1| PREDICTED: 40S ribosomal protein S15 isoform 1 [Gorilla gorilla gorilla] gi|471381552|ref|XP_004378568.1| PREDICTED: 40S ribosomal protein S15 [Trichechus manatus latirostris] gi|472351566|ref|XP_004395466.1| PREDICTED: 40S ribosomal protein S15 [Odobenus rosmarus divergens] gi|478534568|ref|XP_004441415.1| PREDICTED: 40S ribosomal protein S15 [Ceratotherium simum simum] gi|488542438|ref|XP_004462792.1| PREDICTED: 40S ribosomal protein S15 [Dasypus novemcinctus] gi|507650939|ref|XP_004632738.1| PREDICTED: 40S ribosomal protein S15 [Octodon degus] gi|512838526|ref|XP_004883974.1| PREDICTED: 40S ribosomal protein S15 [Heterocephalus glaber] gi|513009167|ref|XP_004866007.1| PREDICTED: 40S ribosomal protein S15 [Heterocephalus glaber] gi|532032402|ref|XP_005359120.1| PREDICTED: 40S ribosomal protein S15 [Microtus ochrogaster] gi|533186010|ref|XP_005406026.1| PREDICTED: 40S ribosomal protein S15 [Chinchilla lanigera] gi|543376055|ref|XP_005531236.1| PREDICTED: 40S ribosomal protein S15 [Pseudopodoces humilis] gi|544507521|ref|XP_005587458.1| PREDICTED: 40S ribosomal protein S15 isoform X2 [Macaca fascicularis] gi|554544325|ref|XP_005866755.1| PREDICTED: 40S ribosomal protein S15-like [Myotis brandtii] gi|560968242|ref|XP_006206493.1| PREDICTED: 40S ribosomal protein S15 [Vicugna pacos] gi|584035117|ref|XP_006764872.1| PREDICTED: 40S ribosomal protein S15-like [Myotis davidii] gi|585703534|ref|XP_006897998.1| PREDICTED: 40S ribosomal protein S15 [Elephantulus edwardii] gi|586519478|ref|XP_006904116.1| PREDICTED: 40S ribosomal protein S15-like [Pteropus alecto] gi|586976169|ref|XP_006928238.1| PREDICTED: 40S ribosomal protein S15 [Felis catus] gi|51338618|sp|P62844.2|RS15_PIG RecName: Full=40S ribosomal protein S15; AltName: Full=RIG protein gi|51338619|sp|P62845.2|RS15_RAT RecName: Full=40S ribosomal protein S15; AltName: Full=RIG protein gi|51338641|sp|P62841.2|RS15_HUMAN RecName: Full=40S ribosomal protein S15; AltName: Full=RIG protein gi|51338642|sp|P62842.2|RS15_MESAU RecName: Full=40S ribosomal protein S15; AltName: Full=RIG protein gi|51338643|sp|P62843.2|RS15_MOUSE RecName: Full=40S ribosomal protein S15; AltName: Full=RIG protein gi|51338644|sp|P62846.2|RS15_CHICK RecName: Full=40S ribosomal protein S15; AltName: Full=RIG protein gi|75061967|sp|Q5RDI7.3|RS15_PONAB RecName: Full=40S ribosomal protein S15 gi|187609270|pdb|2ZKQ|SS Chain s, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map gi|485601398|pdb|3J3A|P Chain P, Structure Of The Human 40s Ribosomal Proteins gi|18000271|gb|AAL54897.1|AF159542_1 ribosomal protein S15 [Hydrophis hardwickii] gi|33150798|gb|AAP97277.1|AF145025_1 insulinoma protein [Homo sapiens] gi|200751|gb|AAA40055.1| insulinoma protein (rig) [Mus musculus] gi|206664|gb|AAA42044.1| DNA-binding protein (putative); putative [Rattus norvegicus] gi|212634|gb|AAA49057.1| insulinoma protein (rig) [Gallus gallus] gi|220899|dbj|BAA01984.1| ribosomal protein S15 [Rattus norvegicus] gi|222860|dbj|BAA01036.1| ribosomal protein S15 [Gallus gallus] gi|305361|gb|AAA37094.1| Rig DNA-binding protein (putative); putative [Mesocricetus auratus] gi|306898|gb|AAA36036.1| rig-analog protein (putative); putative [Homo sapiens] gi|337416|gb|AAA36568.1| human homologue of rat insulinoma gene (rig); putative [Homo sapiens] gi|2258091|dbj|BAA21510.1| rig-analog DNA-binding protein [Sus scrofa] gi|14789682|gb|AAH10763.1| Ribosomal protein S15 [Mus musculus] gi|40787646|gb|AAH64908.1| Ribosomal protein S15 [Homo sapiens] gi|55726821|emb|CAH90170.1| hypothetical protein [Pongo abelii] gi|62948149|gb|AAH94409.1| Ribosomal protein S15 [Mus musculus] gi|77415476|gb|AAI05811.1| Ribosomal protein S15 [Homo sapiens] gi|146327156|gb|AAI41833.1| Ribosomal protein S15 [Homo sapiens] gi|148699624|gb|EDL31571.1| mCG13420 [Mus musculus] gi|149034563|gb|EDL89300.1| ribosomal protein S15 [Rattus norvegicus] gi|156857633|gb|ABU96168.1| ribosomal protein S15 [Ailuropoda melanoleuca] gi|261858660|dbj|BAI45852.1| 40S ribosomal protein S15 [synthetic construct] gi|351699555|gb|EHB02474.1| 40S ribosomal protein S15 [Heterocephalus glaber] gi|431922221|gb|ELK19312.1| 40S ribosomal protein S15 [Pteropus alecto] Length = 145 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYL EFSITYKPVKHGRPGIGATHSSRFIPLK Sbjct: 110 EMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 145 >gb|EUB58429.1| 40S ribosomal protein S15-B [Echinococcus granulosus] Length = 187 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYL EFSITYKPVKHGRPGIGATHSSRFIPLK Sbjct: 152 EMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 187 >ref|XP_006650736.1| PREDICTED: 40S ribosomal protein S15-like [Oryza brachyantha] gi|573926409|ref|XP_006650737.1| PREDICTED: 40S ribosomal protein S15-like [Oryza brachyantha] Length = 154 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 119 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 154 >ref|XP_006640013.1| PREDICTED: 40S ribosomal protein S15-like [Lepisosteus oculatus] Length = 165 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYL EFSITYKPVKHGRPGIGATHSSRFIPLK Sbjct: 130 EMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 165 >ref|XP_006352119.1| PREDICTED: 40S ribosomal protein S15-like [Solanum tuberosum] Length = 151 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 116 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 151 >ref|XP_006350663.1| PREDICTED: 40S ribosomal protein S15-like [Solanum tuberosum] Length = 151 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 116 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 151 >ref|XP_006171827.1| PREDICTED: 40S ribosomal protein S15 [Tupaia chinensis] Length = 119 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYL EFSITYKPVKHGRPGIGATHSSRFIPLK Sbjct: 84 EMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 119 >gb|ESW32413.1| hypothetical protein PHAVU_002G320200g [Phaseolus vulgaris] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 117 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >gb|ESW26074.1| hypothetical protein PHAVU_003G089200g [Phaseolus vulgaris] Length = 152 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 117 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 152 >gb|ESW16696.1| hypothetical protein PHAVU_007G178000g [Phaseolus vulgaris] Length = 151 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 116 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 151 >ref|XP_006125018.1| PREDICTED: 40S ribosomal protein S15 [Pelodiscus sinensis] Length = 168 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYL EFSITYKPVKHGRPGIGATHSSRFIPLK Sbjct: 133 EMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 168 >ref|XP_006443898.1| hypothetical protein CICLE_v10022652mg [Citrus clementina] gi|568851807|ref|XP_006479578.1| PREDICTED: 40S ribosomal protein S15-like [Citrus sinensis] gi|557546160|gb|ESR57138.1| hypothetical protein CICLE_v10022652mg [Citrus clementina] Length = 155 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 120 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 155 >ref|XP_006443897.1| hypothetical protein CICLE_v10022652mg [Citrus clementina] gi|557546159|gb|ESR57137.1| hypothetical protein CICLE_v10022652mg [Citrus clementina] Length = 118 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 83 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 118 >ref|XP_006420117.1| hypothetical protein CICLE_v10006127mg [Citrus clementina] gi|568872733|ref|XP_006489520.1| PREDICTED: 40S ribosomal protein S15-like [Citrus sinensis] gi|557521990|gb|ESR33357.1| hypothetical protein CICLE_v10006127mg [Citrus clementina] Length = 155 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 EMIGHYLAEFSITYKPVKHGRPGIGATHSSRFIPLK 108 EMIGHYLAEFSI+YKPVKHGRPGIGATHSSRFIPLK Sbjct: 120 EMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 155