BLASTX nr result
ID: Catharanthus22_contig00001637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00001637 (458 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006442999.1| hypothetical protein CICLE_v10021980mg [Citr... 58 1e-06 ref|XP_004309809.1| PREDICTED: salt tolerance protein-like [Frag... 57 2e-06 gb|ADL36673.1| COL domain class transcription factor [Malus dome... 57 3e-06 >ref|XP_006442999.1| hypothetical protein CICLE_v10021980mg [Citrus clementina] gi|568850007|ref|XP_006478724.1| PREDICTED: salt tolerance-like protein-like isoform X1 [Citrus sinensis] gi|568850009|ref|XP_006478725.1| PREDICTED: salt tolerance-like protein-like isoform X2 [Citrus sinensis] gi|557545261|gb|ESR56239.1| hypothetical protein CICLE_v10021980mg [Citrus clementina] Length = 238 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = -1 Query: 455 TTYKPPKFSMSYKKPRIEVPDDEEEFFTVPDLG 357 ++Y+P KF+M YKKPRIE+PDD++E FTVPDLG Sbjct: 206 SSYRPTKFNMPYKKPRIEIPDDDDEHFTVPDLG 238 >ref|XP_004309809.1| PREDICTED: salt tolerance protein-like [Fragaria vesca subsp. vesca] Length = 238 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 455 TTYKPPKFSMSYKKPRIEVPDDEEEFFTVPDLG 357 T+Y+PPK + YKKPRIE+PDD++E FTVPDLG Sbjct: 204 TSYRPPKSNSPYKKPRIEIPDDDDEHFTVPDLG 236 >gb|ADL36673.1| COL domain class transcription factor [Malus domestica] Length = 239 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 455 TTYKPPKFSMSYKKPRIEVPDDEEEFFTVPDLG 357 T+Y+PPK S KKPRIE+PDD++E+FTVPDLG Sbjct: 205 TSYRPPKSSSPQKKPRIEIPDDDDEYFTVPDLG 237