BLASTX nr result
ID: Catharanthus22_contig00000806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00000806 (584 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor... 100 3e-19 gb|EOX91381.1| Cyclin-dependent kinase inhibitor family protein,... 99 1e-18 gb|EOX91380.1| Cyclin-dependent kinase inhibitor family protein,... 99 1e-18 emb|CBI21439.3| unnamed protein product [Vitis vinifera] 99 1e-18 ref|XP_002523560.1| conserved hypothetical protein [Ricinus comm... 93 6e-17 ref|XP_006425866.1| hypothetical protein CICLE_v10026517mg [Citr... 90 4e-16 gb|EXB55911.1| Cyclin-dependent kinase inhibitor 7 [Morus notabi... 89 8e-16 gb|ESW27928.1| hypothetical protein PHAVU_003G244700g [Phaseolus... 81 2e-13 gb|AFK38333.1| unknown [Lotus japonicus] 80 4e-13 ref|NP_001238139.1| cyclin-dependent kinase inhibitor 1;2 [Glyci... 79 7e-13 gb|ESW28805.1| hypothetical protein PHAVU_002G019500g [Phaseolus... 79 1e-12 ref|XP_002282040.2| PREDICTED: cyclin-dependent kinase inhibitor... 79 1e-12 emb|CBI32432.3| unnamed protein product [Vitis vinifera] 79 1e-12 ref|NP_001237200.1| cyclin-dependent kinase inhibitor 1;1 [Glyci... 79 1e-12 ref|XP_004230818.1| PREDICTED: cyclin-dependent kinase inhibitor... 78 1e-12 ref|XP_004136985.1| PREDICTED: cyclin-dependent kinase inhibitor... 78 1e-12 emb|CAD56868.1| cyclin-dependent kinase inhibitor [Nicotiana tab... 78 1e-12 ref|XP_006487083.1| PREDICTED: cyclin-dependent kinase inhibitor... 78 2e-12 ref|XP_006423046.1| hypothetical protein CICLE_v10029306mg [Citr... 78 2e-12 ref|XP_004294829.1| PREDICTED: cyclin-dependent kinase inhibitor... 77 3e-12 >ref|XP_002282199.2| PREDICTED: cyclin-dependent kinase inhibitor 1-like [Vitis vinifera] Length = 227 Score = 100 bits (249), Expect = 3e-19 Identities = 56/91 (61%), Positives = 70/91 (76%) Frame = +1 Query: 1 RKEETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEK 180 R+ TTPSSE++AE S DLES TARP SE N R RST + +MPS +E+EEFF+AAEK Sbjct: 143 RERRETTPSSELRAE-SDDLES-TARP--SEANYRHRSTVE--KMPSESELEEFFAAAEK 196 Query: 181 EHKKHFSEKYNFDFVNEQPLEGRYSWVRVKP 273 + +K FSEKYN+D V + P+EGRY WVR+KP Sbjct: 197 DVQKRFSEKYNYDIVKDVPMEGRYEWVRLKP 227 >gb|EOX91381.1| Cyclin-dependent kinase inhibitor family protein, putative isoform 2 [Theobroma cacao] Length = 230 Score = 98.6 bits (244), Expect = 1e-18 Identities = 52/86 (60%), Positives = 63/86 (73%) Frame = +1 Query: 16 TTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEHKKH 195 TTPSSE++AE E + SEVNSR RST + P AEIEEFF++AEK+ +KH Sbjct: 135 TTPSSELRAEP----EDQDSMSKPSEVNSRRRSTVEKIN-PIKAEIEEFFASAEKDLQKH 189 Query: 196 FSEKYNFDFVNEQPLEGRYSWVRVKP 273 F+EKYNFDFV E+PLEGRY WVR+KP Sbjct: 190 FTEKYNFDFVKEEPLEGRYEWVRLKP 215 >gb|EOX91380.1| Cyclin-dependent kinase inhibitor family protein, putative isoform 1 [Theobroma cacao] Length = 231 Score = 98.6 bits (244), Expect = 1e-18 Identities = 52/86 (60%), Positives = 63/86 (73%) Frame = +1 Query: 16 TTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEHKKH 195 TTPSSE++AE E + SEVNSR RST + P AEIEEFF++AEK+ +KH Sbjct: 136 TTPSSELRAEP----EDQDSMSKPSEVNSRRRSTVEKIN-PIKAEIEEFFASAEKDLQKH 190 Query: 196 FSEKYNFDFVNEQPLEGRYSWVRVKP 273 F+EKYNFDFV E+PLEGRY WVR+KP Sbjct: 191 FTEKYNFDFVKEEPLEGRYEWVRLKP 216 >emb|CBI21439.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 98.6 bits (244), Expect = 1e-18 Identities = 55/86 (63%), Positives = 68/86 (79%) Frame = +1 Query: 16 TTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEHKKH 195 TTPSSE++AE S DLES TARP SE N R RST + +MPS +E+EEFF+AAEK+ +K Sbjct: 133 TTPSSELRAE-SDDLES-TARP--SEANYRHRSTVE--KMPSESELEEFFAAAEKDVQKR 186 Query: 196 FSEKYNFDFVNEQPLEGRYSWVRVKP 273 FSEKYN+D V + P+EGRY WVR+KP Sbjct: 187 FSEKYNYDIVKDVPMEGRYEWVRLKP 212 >ref|XP_002523560.1| conserved hypothetical protein [Ricinus communis] gi|223537122|gb|EEF38755.1| conserved hypothetical protein [Ricinus communis] Length = 219 Score = 92.8 bits (229), Expect = 6e-17 Identities = 43/91 (47%), Positives = 65/91 (71%) Frame = +1 Query: 1 RKEETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEK 180 R+ +TPSSE+ E S +L+S TARP+ E NSR + + +MP+ E++EFF+ AE+ Sbjct: 130 RERRESTPSSEVGEELSDELDS-TARPSAMEANSRRKPSLTVEKMPTETELDEFFAEAER 188 Query: 181 EHKKHFSEKYNFDFVNEQPLEGRYSWVRVKP 273 +K F++KYN+D V ++PL+GRY WVR+KP Sbjct: 189 NIQKRFADKYNYDVVKDEPLKGRYEWVRLKP 219 >ref|XP_006425866.1| hypothetical protein CICLE_v10026517mg [Citrus clementina] gi|568824471|ref|XP_006466624.1| PREDICTED: cyclin-dependent kinase inhibitor 1-like isoform X1 [Citrus sinensis] gi|557527856|gb|ESR39106.1| hypothetical protein CICLE_v10026517mg [Citrus clementina] Length = 203 Score = 90.1 bits (222), Expect = 4e-16 Identities = 48/93 (51%), Positives = 67/93 (72%), Gaps = 2/93 (2%) Frame = +1 Query: 1 RKEETTTPSSEIQAEQSGDLES--NTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAA 174 R+ T SSE++AE + +S +TA+P+ SE NSR RST + MP+ +EIE+FF+ A Sbjct: 114 RERRDATLSSELEAEAGEESDSLDSTAKPS-SEANSRRRSTVE--NMPAKSEIEDFFAEA 170 Query: 175 EKEHKKHFSEKYNFDFVNEQPLEGRYSWVRVKP 273 EK+ K FS+KYNFDFV E+P+EGRY WV ++P Sbjct: 171 EKKLVKQFSQKYNFDFVKEEPMEGRYKWVGLRP 203 >gb|EXB55911.1| Cyclin-dependent kinase inhibitor 7 [Morus notabilis] Length = 251 Score = 89.0 bits (219), Expect = 8e-16 Identities = 45/85 (52%), Positives = 64/85 (75%) Frame = +1 Query: 19 TPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEHKKHF 198 TPSS+++ E+S D+ES A+PT + +SR +K MPS +E+EEFF+AAEK+ +K F Sbjct: 172 TPSSKLR-EESDDVES-AAKPTVVDSHSRSAVAEK---MPSESELEEFFAAAEKDIQKRF 226 Query: 199 SEKYNFDFVNEQPLEGRYSWVRVKP 273 +EKYN+D V + PLEGRY W+R+KP Sbjct: 227 AEKYNYDIVKDTPLEGRYEWLRLKP 251 >gb|ESW27928.1| hypothetical protein PHAVU_003G244700g [Phaseolus vulgaris] Length = 191 Score = 81.3 bits (199), Expect = 2e-13 Identities = 39/83 (46%), Positives = 57/83 (68%) Frame = +1 Query: 25 SSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEHKKHFSE 204 SSE++ S +++S A T+ SRC + + P+++E+EEFF+AAEK+ K FSE Sbjct: 111 SSELRIPNSQEVDS--AEKKTTITKSRCCVSSALQKRPTDSELEEFFAAAEKDIHKRFSE 168 Query: 205 KYNFDFVNEQPLEGRYSWVRVKP 273 KYN+D V + PLEGRY WV++KP Sbjct: 169 KYNYDIVKDVPLEGRYEWVKLKP 191 >gb|AFK38333.1| unknown [Lotus japonicus] Length = 193 Score = 80.1 bits (196), Expect = 4e-13 Identities = 37/81 (45%), Positives = 54/81 (66%) Frame = +1 Query: 31 EIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEHKKHFSEKY 210 E + E + E +T+ T+S+ +K +MP+ +E+EEFFSAAEK+ +K FS KY Sbjct: 113 EEEEETTRKREMSTSHGTSSQEVDSVEEKEKLQKMPTESELEEFFSAAEKDIQKRFSHKY 172 Query: 211 NFDFVNEQPLEGRYSWVRVKP 273 N+D V + PLEGRY WV++KP Sbjct: 173 NYDIVKDVPLEGRYEWVQLKP 193 >ref|NP_001238139.1| cyclin-dependent kinase inhibitor 1;2 [Glycine max] gi|46844158|gb|AAS13375.1| cyclin-dependent kinase inhibitor 1;2 [Glycine max] Length = 198 Score = 79.3 bits (194), Expect = 7e-13 Identities = 37/79 (46%), Positives = 51/79 (64%) Frame = +1 Query: 37 QAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEHKKHFSEKYNF 216 + + S +L N+ P E+NS R+ K MP+ E EEFF AAEK+ +K F +KYN+ Sbjct: 121 EMKSSSELRENSQEPEPMEINSH-RALSKAKAMPTELEXEEFFVAAEKDIQKRFQDKYNY 179 Query: 217 DFVNEQPLEGRYSWVRVKP 273 D V + PLEGRY WV++KP Sbjct: 180 DIVKDVPLEGRYEWVQLKP 198 >gb|ESW28805.1| hypothetical protein PHAVU_002G019500g [Phaseolus vulgaris] Length = 200 Score = 78.6 bits (192), Expect = 1e-12 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 5/93 (5%) Frame = +1 Query: 10 ETTTPSSEIQAEQ-----SGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAA 174 ET+T + Q E+ S +L N+ + E+NSR R + K MPS E+EEFF A Sbjct: 109 ETSTCNGASQIERKEMNRSSELLENSEELESVEINSR-RDSSKARTMPSELELEEFFVTA 167 Query: 175 EKEHKKHFSEKYNFDFVNEQPLEGRYSWVRVKP 273 EK+ +K F +KYN+D V + PLEGRY WV++KP Sbjct: 168 EKDIQKRFQDKYNYDVVKDVPLEGRYEWVQLKP 200 >ref|XP_002282040.2| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Vitis vinifera] Length = 203 Score = 78.6 bits (192), Expect = 1e-12 Identities = 45/90 (50%), Positives = 62/90 (68%) Frame = +1 Query: 1 RKEETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEK 180 R TTP SE+ A+ S ++ES TA+ T ++ R +ST +MPS EIEEFFSAAEK Sbjct: 119 RFSRETTPVSELYAD-SAEMES-TAKTTAAK--PRRKSTAG--KMPSTVEIEEFFSAAEK 172 Query: 181 EHKKHFSEKYNFDFVNEQPLEGRYSWVRVK 270 ++ F+EKYN+D V + P+EGRY WVR++ Sbjct: 173 YQQQRFAEKYNYDIVKDAPMEGRYQWVRLE 202 >emb|CBI32432.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 78.6 bits (192), Expect = 1e-12 Identities = 45/90 (50%), Positives = 62/90 (68%) Frame = +1 Query: 1 RKEETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEK 180 R TTP SE+ A+ S ++ES TA+ T ++ R +ST +MPS EIEEFFSAAEK Sbjct: 150 RFSRETTPVSELYAD-SAEMES-TAKTTAAK--PRRKSTAG--KMPSTVEIEEFFSAAEK 203 Query: 181 EHKKHFSEKYNFDFVNEQPLEGRYSWVRVK 270 ++ F+EKYN+D V + P+EGRY WVR++ Sbjct: 204 YQQQRFAEKYNYDIVKDAPMEGRYQWVRLE 233 >ref|NP_001237200.1| cyclin-dependent kinase inhibitor 1;1 [Glycine max] gi|42362358|gb|AAS13374.1| cyclin-dependent kinase inhibitor 1;1 [Glycine max] Length = 205 Score = 78.6 bits (192), Expect = 1e-12 Identities = 35/79 (44%), Positives = 53/79 (67%) Frame = +1 Query: 37 QAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEHKKHFSEKYNF 216 + ++S +L N+ P E+NS R K MP+ E+EEFF+A+EK+ +K F ++YN+ Sbjct: 128 EMKRSSELRENSQEPEPMEINSH-RVLSKAKAMPTELELEEFFAASEKDIQKRFQDRYNY 186 Query: 217 DFVNEQPLEGRYSWVRVKP 273 D V + PLEGRY WV++KP Sbjct: 187 DIVKDVPLEGRYEWVQLKP 205 >ref|XP_004230818.1| PREDICTED: cyclin-dependent kinase inhibitor 6-like [Solanum lycopersicum] Length = 222 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/82 (47%), Positives = 52/82 (63%), Gaps = 4/82 (4%) Frame = +1 Query: 40 AEQSGDLESNTARPTTSEVNSRCRSTDKYY----EMPSNAEIEEFFSAAEKEHKKHFSEK 207 +E GD E + TT++ +S S + ++P AEIEEFFSAAEK +K F+EK Sbjct: 136 SEHCGDSEDMESSSTTTKKSSSSASAPRKQLSASKVPPEAEIEEFFSAAEKREQKRFAEK 195 Query: 208 YNFDFVNEQPLEGRYSWVRVKP 273 YN+D V + PLEGRY WV +KP Sbjct: 196 YNYDIVKDAPLEGRYQWVSLKP 217 >ref|XP_004136985.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Cucumis sativus] Length = 208 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/89 (42%), Positives = 58/89 (65%) Frame = +1 Query: 7 EETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEH 186 + +TP+S + + S +++S P T + + + TD+ + P +EIE+FFS AEK Sbjct: 125 QRESTPTSNLMGD-SDEMDS----PATIFLTEKQKPTDRPMKTPPISEIEDFFSEAEKYE 179 Query: 187 KKHFSEKYNFDFVNEQPLEGRYSWVRVKP 273 +K FSEKYNFD + + PLEGRY W+R+KP Sbjct: 180 QKRFSEKYNFDIIMDVPLEGRYQWIRLKP 208 >emb|CAD56868.1| cyclin-dependent kinase inhibitor [Nicotiana tabacum] Length = 207 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/91 (45%), Positives = 56/91 (61%), Gaps = 2/91 (2%) Frame = +1 Query: 7 EETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEH 186 EE T + ++++S E PTT + + R +MPS ++EEFF+AAEK+ Sbjct: 117 EEETVEIATSKSKESIKAELRQMEPTTRAHHPKSRRRLTEEKMPSETDLEEFFAAAEKDI 176 Query: 187 KKHFSEKYNFDFVNEQPLEGRYSWVR--VKP 273 K F++KYNFDFV E+PLEG Y WVR VKP Sbjct: 177 LKRFTKKYNFDFVKEEPLEGHYEWVRSTVKP 207 >ref|XP_006487083.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Citrus sinensis] Length = 200 Score = 77.8 bits (190), Expect = 2e-12 Identities = 39/87 (44%), Positives = 57/87 (65%) Frame = +1 Query: 7 EETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEH 186 +E T+P SEI + + T E + R S+++ ++PS AEI+EFF+AAEK Sbjct: 110 KEETSPLSEICGDSEDQTSMDKPSKTPPESHRRKPSSEEE-KIPSAAEIDEFFTAAEKRE 168 Query: 187 KKHFSEKYNFDFVNEQPLEGRYSWVRV 267 ++ F+EKYN+D VN+ PLEGRY WVR+ Sbjct: 169 QERFAEKYNYDIVNDLPLEGRYQWVRL 195 >ref|XP_006423046.1| hypothetical protein CICLE_v10029306mg [Citrus clementina] gi|557524980|gb|ESR36286.1| hypothetical protein CICLE_v10029306mg [Citrus clementina] Length = 200 Score = 77.8 bits (190), Expect = 2e-12 Identities = 39/87 (44%), Positives = 57/87 (65%) Frame = +1 Query: 7 EETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKEH 186 +E T+P SEI + + T E + R S+++ ++PS AEI+EFF+AAEK Sbjct: 110 KEETSPLSEICGDSEDQTSMDKPSKTPPESHRRKPSSEEE-KIPSAAEIDEFFTAAEKRE 168 Query: 187 KKHFSEKYNFDFVNEQPLEGRYSWVRV 267 ++ F+EKYN+D VN+ PLEGRY WVR+ Sbjct: 169 QERFAEKYNYDIVNDLPLEGRYQWVRL 195 >ref|XP_004294829.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like isoform 2 [Fragaria vesca subsp. vesca] Length = 176 Score = 77.4 bits (189), Expect = 3e-12 Identities = 43/90 (47%), Positives = 53/90 (58%) Frame = +1 Query: 4 KEETTTPSSEIQAEQSGDLESNTARPTTSEVNSRCRSTDKYYEMPSNAEIEEFFSAAEKE 183 K TTPSSE+ E S +++S P S+ P + EIEEFF+ AEK Sbjct: 104 KFRETTPSSELCLENSEEMDS----PAVSK-------------SPPSDEIEEFFATAEKY 146 Query: 184 HKKHFSEKYNFDFVNEQPLEGRYSWVRVKP 273 +K F+EKYNFD V E PLEGRY WVR+KP Sbjct: 147 EQKRFAEKYNFDIVKEAPLEGRYHWVRLKP 176