BLASTX nr result
ID: Catharanthus22_contig00000769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00000769 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002329111.1| predicted protein [Populus trichocarpa] gi|5... 66 6e-09 ref|XP_004487677.1| PREDICTED: uncharacterized protein LOC101506... 65 1e-08 ref|XP_006300207.1| hypothetical protein CARUB_v10016443mg [Caps... 64 2e-08 ref|XP_006406960.1| hypothetical protein EUTSA_v10021811mg [Eutr... 64 3e-08 gb|EOY12851.1| Uncharacterized protein TCM_031362 [Theobroma cacao] 64 3e-08 ref|XP_002316920.2| hypothetical protein POPTR_0011s12430g [Popu... 63 4e-08 dbj|BAF02554.1| hypothetical protein [Nicotiana benthamiana] 63 4e-08 ref|XP_002532684.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|NP_001118635.1| uncharacterized protein [Arabidopsis thalian... 61 2e-07 gb|ESW21611.1| hypothetical protein PHAVU_005G084800g [Phaseolus... 60 2e-07 ref|XP_002882949.1| hypothetical protein ARALYDRAFT_478998 [Arab... 59 5e-07 >ref|XP_002329111.1| predicted protein [Populus trichocarpa] gi|566154106|ref|XP_006370308.1| hypothetical protein POPTR_0001s41500g [Populus trichocarpa] gi|550349487|gb|ERP66877.1| hypothetical protein POPTR_0001s41500g [Populus trichocarpa] Length = 108 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/45 (68%), Positives = 35/45 (77%) Frame = +1 Query: 148 SDKFRRREAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMSMA 282 SDK RR +A EILRRAL PP +R TLRW +F+P PSRL NMSMA Sbjct: 64 SDKLRRNQANTEILRRALAPPNRRLTLRWFNFQPTPSRLSNMSMA 108 >ref|XP_004487677.1| PREDICTED: uncharacterized protein LOC101506036 [Cicer arietinum] Length = 109 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +1 Query: 151 DKFRRREAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMSMA 282 ++ ++R A KEILRRALTPP KR LRWL+F+P PSRL NMSMA Sbjct: 62 ERLKKRVASKEILRRALTPPPKRLGLRWLNFKPTPSRLSNMSMA 105 >ref|XP_006300207.1| hypothetical protein CARUB_v10016443mg [Capsella rubella] gi|482568916|gb|EOA33105.1| hypothetical protein CARUB_v10016443mg [Capsella rubella] Length = 107 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/58 (51%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +1 Query: 109 STRGFRPEMAAATSDKFRRR--EAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMS 276 ST+ R T ++ R+ + +E+LRRALTPP++R LRWL+FRP PSRLCNMS Sbjct: 48 STKCARHGFMVPTDERLMRKASDGSREVLRRALTPPIRRMNLRWLNFRPTPSRLCNMS 105 >ref|XP_006406960.1| hypothetical protein EUTSA_v10021811mg [Eutrema salsugineum] gi|557108106|gb|ESQ48413.1| hypothetical protein EUTSA_v10021811mg [Eutrema salsugineum] Length = 106 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = +1 Query: 109 STRGFRPEMAAATSDKFRRR--EAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMS 276 ST+ R + DK R+ + +E+LRRALTPP++R LRWL+FRP PSRLC MS Sbjct: 47 STKCVRHGFMVPSDDKLTRKASDGSREVLRRALTPPIRRMNLRWLNFRPTPSRLCRMS 104 >gb|EOY12851.1| Uncharacterized protein TCM_031362 [Theobroma cacao] Length = 115 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +1 Query: 160 RRREAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMSMA 282 RR A KEILRRALTPP ++ TLRW +FRP PSRL NMSMA Sbjct: 75 RRNSANKEILRRALTPPNRKMTLRWWNFRPTPSRLSNMSMA 115 >ref|XP_002316920.2| hypothetical protein POPTR_0011s12430g [Populus trichocarpa] gi|550328226|gb|EEE97532.2| hypothetical protein POPTR_0011s12430g [Populus trichocarpa] Length = 109 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 160 RRREAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMSMA 282 RR +A KE+LRRAL PP +R TLRW +FRP PSRL NMSMA Sbjct: 69 RRHQANKELLRRALAPPNRRLTLRWFNFRPTPSRLSNMSMA 109 >dbj|BAF02554.1| hypothetical protein [Nicotiana benthamiana] Length = 109 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 172 AKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMSMA 282 A KEI++RALTPP R TLRWLDF+P PSRLCNMS A Sbjct: 73 ANKEIIKRALTPPAPRLTLRWLDFKPTPSRLCNMSAA 109 >ref|XP_002532684.1| conserved hypothetical protein [Ricinus communis] gi|223527581|gb|EEF29697.1| conserved hypothetical protein [Ricinus communis] Length = 117 Score = 61.2 bits (147), Expect = 1e-07 Identities = 38/82 (46%), Positives = 46/82 (56%), Gaps = 9/82 (10%) Frame = +1 Query: 64 YMHR-GIGGLPRQGARSTRGFRPEMAAAT-------SDKFRRR-EAKKEILRRALTPPVK 216 Y H G PR + T RP + SDK RR +A +EILRRAL PP + Sbjct: 36 YQHSSGPASSPRPRSTCTCSNRPGSVRCSKHGYVLPSDKLRRHHQASREILRRALAPPNR 95 Query: 217 RPTLRWLDFRPVPSRLCNMSMA 282 + +LRW +FRP PSRL NMSMA Sbjct: 96 KMSLRWWNFRPTPSRLSNMSMA 117 >ref|NP_001118635.1| uncharacterized protein [Arabidopsis thaliana] gi|26450598|dbj|BAC42411.1| unknown protein [Arabidopsis thaliana] gi|332642164|gb|AEE75685.1| uncharacterized protein AT3G15518 [Arabidopsis thaliana] Length = 106 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 2/58 (3%) Frame = +1 Query: 109 STRGFRPEMAAATSDKFRRR--EAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMS 276 ST+ R + ++ R+ + +E+LRRALTPP++R LRWL+FRP PSRLC MS Sbjct: 47 STKCARHGFVVPSDERLMRKASDGSREVLRRALTPPIRRMNLRWLNFRPTPSRLCKMS 104 >gb|ESW21611.1| hypothetical protein PHAVU_005G084800g [Phaseolus vulgaris] Length = 111 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +1 Query: 160 RRREAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMSMA 282 ++R A KEILRRALTPP KR LRWL+FRP PSRL NMSMA Sbjct: 72 KKRVASKEILRRALTPP-KRLGLRWLNFRPTPSRLSNMSMA 111 >ref|XP_002882949.1| hypothetical protein ARALYDRAFT_478998 [Arabidopsis lyrata subsp. lyrata] gi|297328789|gb|EFH59208.1| hypothetical protein ARALYDRAFT_478998 [Arabidopsis lyrata subsp. lyrata] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 169 EAKKEILRRALTPPVKRPTLRWLDFRPVPSRLCNMS 276 + +E+LRRALTPP++R LRWL+FRP PSRLC MS Sbjct: 69 DGSREVLRRALTPPIRRMNLRWLNFRPTPSRLCKMS 104