BLASTX nr result
ID: Catharanthus22_contig00000690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00000690 (566 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004515368.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 78 1e-12 ref|XP_006375118.1| hypothetical protein POPTR_0014s04510g [Popu... 78 2e-12 ref|XP_006375116.1| hypothetical protein POPTR_0014s04510g [Popu... 78 2e-12 ref|XP_006375114.1| hypothetical protein POPTR_0014s04510g [Popu... 78 2e-12 ref|XP_002327057.1| predicted protein [Populus trichocarpa] gi|5... 78 2e-12 ref|XP_006359593.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 76 7e-12 gb|EPS68814.1| hypothetical protein M569_05956, partial [Genlise... 76 7e-12 ref|XP_004248526.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 76 7e-12 ref|XP_004170977.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 76 7e-12 ref|XP_004133781.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 76 7e-12 ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-tra... 75 9e-12 ref|XP_006445401.1| hypothetical protein CICLE_v10021814mg [Citr... 75 1e-11 ref|XP_006445400.1| hypothetical protein CICLE_v10021814mg [Citr... 75 1e-11 ref|XP_003563091.1| PREDICTED: FKBP-type peptidyl-prolyl cis-tra... 75 1e-11 ref|XP_003563090.1| PREDICTED: FKBP-type peptidyl-prolyl cis-tra... 75 1e-11 gb|EXB37626.1| Peptidyl-prolyl cis-trans isomerase FKBP20-2 [Mor... 74 3e-11 ref|XP_006402588.1| hypothetical protein EUTSA_v10006207mg [Eutr... 73 4e-11 ref|XP_002301227.2| hypothetical protein POPTR_0002s13760g [Popu... 72 7e-11 ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycin... 72 1e-10 ref|XP_006583534.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 72 1e-10 >ref|XP_004515368.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Cicer arietinum] Length = 259 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ IKDC RRTIGFYSDVVCN Sbjct: 221 VGPSTFFSSKQFEVFDVELLSIKDCERRTIGFYSDVVCN 259 >ref|XP_006375118.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] gi|550323434|gb|ERP52915.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] Length = 258 Score = 77.8 bits (190), Expect = 2e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ +KDC RRTIGFYSDVVCN Sbjct: 220 VGPSTFFSSKQFEVFDVELLNVKDCQRRTIGFYSDVVCN 258 >ref|XP_006375116.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] gi|550323432|gb|ERP52913.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] Length = 214 Score = 77.8 bits (190), Expect = 2e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ +KDC RRTIGFYSDVVCN Sbjct: 176 VGPSTFFSSKQFEVFDVELLNVKDCQRRTIGFYSDVVCN 214 >ref|XP_006375114.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] gi|550323430|gb|ERP52911.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] Length = 186 Score = 77.8 bits (190), Expect = 2e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ +KDC RRTIGFYSDVVCN Sbjct: 148 VGPSTFFSSKQFEVFDVELLNVKDCQRRTIGFYSDVVCN 186 >ref|XP_002327057.1| predicted protein [Populus trichocarpa] gi|566202487|ref|XP_006375115.1| immunophilin family protein [Populus trichocarpa] gi|550323431|gb|ERP52912.1| immunophilin family protein [Populus trichocarpa] Length = 210 Score = 77.8 bits (190), Expect = 2e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ +KDC RRTIGFYSDVVCN Sbjct: 172 VGPSTFFSSKQFEVFDVELLNVKDCQRRTIGFYSDVVCN 210 >ref|XP_006359593.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Solanum tuberosum] Length = 253 Score = 75.9 bits (185), Expect = 7e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ ++DC RRTIGFYSDVVCN Sbjct: 215 VGPSTFFSSKQFEVFDVELLDVQDCKRRTIGFYSDVVCN 253 >gb|EPS68814.1| hypothetical protein M569_05956, partial [Genlisea aurea] Length = 196 Score = 75.9 bits (185), Expect = 7e-12 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQ+EVFDVEL+ I+DC+RRTIGFYSD+VCN Sbjct: 158 VGPSTFFSSKQYEVFDVELLSIQDCSRRTIGFYSDIVCN 196 >ref|XP_004248526.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Solanum lycopersicum] Length = 257 Score = 75.9 bits (185), Expect = 7e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ ++DC RRTIGFYSDVVCN Sbjct: 219 VGPSTFFSSKQFEVFDVELLDVQDCKRRTIGFYSDVVCN 257 >ref|XP_004170977.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like, partial [Cucumis sativus] Length = 137 Score = 75.9 bits (185), Expect = 7e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ ++DC RRTIGFYSD+VCN Sbjct: 99 VGPSTFFSSKQFEVFDVELLSVQDCQRRTIGFYSDIVCN 137 >ref|XP_004133781.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Cucumis sativus] Length = 260 Score = 75.9 bits (185), Expect = 7e-12 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ ++DC RRTIGFYSD+VCN Sbjct: 222 VGPSTFFSSKQFEVFDVELLSVQDCQRRTIGFYSDIVCN 260 >ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic [Vitis vinifera] gi|297734593|emb|CBI16644.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 75.5 bits (184), Expect = 9e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVC 114 VGPSTFFSSKQFEVFDVEL+ +KDC RRTIGFYSDVVC Sbjct: 220 VGPSTFFSSKQFEVFDVELLNVKDCQRRTIGFYSDVVC 257 >ref|XP_006445401.1| hypothetical protein CICLE_v10021814mg [Citrus clementina] gi|568819815|ref|XP_006464440.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Citrus sinensis] gi|557547663|gb|ESR58641.1| hypothetical protein CICLE_v10021814mg [Citrus clementina] Length = 254 Score = 75.1 bits (183), Expect = 1e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFS+KQFEVFDVEL+ ++DC RRTIGFYSDVVCN Sbjct: 216 VGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN 254 >ref|XP_006445400.1| hypothetical protein CICLE_v10021814mg [Citrus clementina] gi|557547662|gb|ESR58640.1| hypothetical protein CICLE_v10021814mg [Citrus clementina] Length = 245 Score = 75.1 bits (183), Expect = 1e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFS+KQFEVFDVEL+ ++DC RRTIGFYSDVVCN Sbjct: 207 VGPSTFFSAKQFEVFDVELLSVQDCQRRTIGFYSDVVCN 245 >ref|XP_003563091.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic-like isoform 2 [Brachypodium distachyon] Length = 208 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFS+KQFEVFDVEL+ +KDC RRTIGFYSDVVC+ Sbjct: 170 VGPSTFFSAKQFEVFDVELLSVKDCERRTIGFYSDVVCS 208 >ref|XP_003563090.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic-like isoform 1 [Brachypodium distachyon] Length = 250 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFS+KQFEVFDVEL+ +KDC RRTIGFYSDVVC+ Sbjct: 212 VGPSTFFSAKQFEVFDVELLSVKDCERRTIGFYSDVVCS 250 >gb|EXB37626.1| Peptidyl-prolyl cis-trans isomerase FKBP20-2 [Morus notabilis] Length = 904 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVC 114 VGPSTFFSSKQFEVFDVELV I+DC RRTIGFYSD VC Sbjct: 866 VGPSTFFSSKQFEVFDVELVSIQDCKRRTIGFYSDFVC 903 >ref|XP_006402588.1| hypothetical protein EUTSA_v10006207mg [Eutrema salsugineum] gi|557103687|gb|ESQ44041.1| hypothetical protein EUTSA_v10006207mg [Eutrema salsugineum] Length = 244 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ I++C RRTIGFYSDV CN Sbjct: 206 VGPSTFFSSKQFEVFDVELLSIQNCQRRTIGFYSDVTCN 244 >ref|XP_002301227.2| hypothetical protein POPTR_0002s13760g [Populus trichocarpa] gi|550344960|gb|EEE80500.2| hypothetical protein POPTR_0002s13760g [Populus trichocarpa] Length = 73 Score = 72.4 bits (176), Expect = 7e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ +KDC R+T GFYSDVVC+ Sbjct: 35 VGPSTFFSSKQFEVFDVELLNLKDCQRKTTGFYSDVVCD 73 >ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycine max] gi|255625657|gb|ACU13173.1| unknown [Glycine max] Length = 248 Score = 72.0 bits (175), Expect = 1e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ +++C RRTI FYSDVVCN Sbjct: 210 VGPSTFFSSKQFEVFDVELLSVQNCERRTIAFYSDVVCN 248 >ref|XP_006583534.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like isoform X3 [Glycine max] gi|571466004|ref|XP_006583535.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like isoform X4 [Glycine max] Length = 205 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +1 Query: 1 VGPSTFFSSKQFEVFDVELVGIKDCTRRTIGFYSDVVCN 117 VGPSTFFSSKQFEVFDVEL+ +++C RRTI FYSDV+CN Sbjct: 167 VGPSTFFSSKQFEVFDVELLSVQNCERRTIAFYSDVICN 205