BLASTX nr result
ID: Catharanthus22_contig00000540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00000540 (297 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235542.1| PREDICTED: auxin-binding protein ABP19a-like... 55 1e-05 gb|ABV03161.1| germin-like protein [Chimonanthus praecox] 55 1e-05 >ref|XP_004235542.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum lycopersicum] Length = 208 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -3 Query: 295 AFFGNNLPTKLVAKTTFLDEALIKKLKSVLGGT 197 A F N+LPTKLVA TTFLDEA IKKLK VLGGT Sbjct: 175 ALFANDLPTKLVAATTFLDEATIKKLKGVLGGT 207 >gb|ABV03161.1| germin-like protein [Chimonanthus praecox] Length = 214 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -3 Query: 295 AFFGNNLPTKLVAKTTFLDEALIKKLKSVLGGTG 194 A F NNLP++LV KTTFLD+A +KKLK+VLGGTG Sbjct: 181 ALFANNLPSELVEKTTFLDDAQVKKLKAVLGGTG 214