BLASTX nr result
ID: Catharanthus22_contig00000493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00000493 (397 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367059.1| PREDICTED: uncharacterized protein LOC102578... 61 1e-07 ref|XP_004236183.1| PREDICTED: uncharacterized protein LOC101243... 61 1e-07 ref|XP_002511500.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 ref|XP_006302127.1| hypothetical protein CARUB_v10020132mg [Caps... 55 1e-05 ref|XP_002266530.2| PREDICTED: uncharacterized protein LOC100244... 55 1e-05 emb|CBI15294.3| unnamed protein product [Vitis vinifera] 55 1e-05 >ref|XP_006367059.1| PREDICTED: uncharacterized protein LOC102578204 [Solanum tuberosum] Length = 544 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 307 KWLAAAASIWIQCSCGASYAFGIYSPILKS 396 KWLAA ASIWIQCS GASYAFGIYSP+LKS Sbjct: 5 KWLAAVASIWIQCSSGASYAFGIYSPVLKS 34 >ref|XP_004236183.1| PREDICTED: uncharacterized protein LOC101243876 [Solanum lycopersicum] Length = 544 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 307 KWLAAAASIWIQCSCGASYAFGIYSPILKS 396 KWLAA ASIWIQCS GASYAFGIYSP+LKS Sbjct: 5 KWLAAVASIWIQCSSGASYAFGIYSPVLKS 34 >ref|XP_002511500.1| conserved hypothetical protein [Ricinus communis] gi|223550615|gb|EEF52102.1| conserved hypothetical protein [Ricinus communis] Length = 551 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +1 Query: 307 KWLAAAASIWIQCSCGASYAFGIYSPILKS 396 KW+A ASIWIQCSCGASY FGIYS ILKS Sbjct: 9 KWIATVASIWIQCSCGASYTFGIYSSILKS 38 >ref|XP_006302127.1| hypothetical protein CARUB_v10020132mg [Capsella rubella] gi|482570837|gb|EOA35025.1| hypothetical protein CARUB_v10020132mg [Capsella rubella] Length = 529 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 301 RGKWLAAAASIWIQCSCGASYAFGIYSPILKS 396 R KW+A AASIWIQC+ GASY FGIYS +LKS Sbjct: 5 RTKWVAMAASIWIQCTSGASYTFGIYSAVLKS 36 >ref|XP_002266530.2| PREDICTED: uncharacterized protein LOC100244916 [Vitis vinifera] Length = 559 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +1 Query: 307 KWLAAAASIWIQCSCGASYAFGIYSPILKS 396 KW+ ASIWIQC+CG SYAFG+YS +LKS Sbjct: 5 KWITTVASIWIQCTCGGSYAFGVYSSVLKS 34 >emb|CBI15294.3| unnamed protein product [Vitis vinifera] Length = 612 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/30 (70%), Positives = 25/30 (83%) Frame = +1 Query: 307 KWLAAAASIWIQCSCGASYAFGIYSPILKS 396 KW+ ASIWIQC+CG SYAFG+YS +LKS Sbjct: 5 KWITTVASIWIQCTCGGSYAFGVYSSVLKS 34