BLASTX nr result
ID: Bupleurum21_contig00038846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038846 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containi... 111 7e-23 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 97 2e-18 ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. l... 94 1e-17 ref|NP_179305.2| pentatricopeptide repeat-containing protein [Ar... 92 6e-17 ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-14 >ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|297744485|emb|CBI37747.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 111 bits (277), Expect = 7e-23 Identities = 52/86 (60%), Positives = 67/86 (77%), Gaps = 2/86 (2%) Frame = +2 Query: 2 ADELSERMLEMPSEGKAQNKVCRDARADKKSK--KYSESDWKAMVHRDDGSGTALKTLRR 175 ADEL+ERM++M SEG +NK+ R+ A + K K+S SDW+ ++HRDDGSG ALK L+R Sbjct: 791 ADELAERMMDMASEGMVENKITRNESAFNRQKRNKFSGSDWQTIIHRDDGSGLALKALKR 850 Query: 176 VQKGWGQGSISSFQLPKSDYLDDWDG 253 VQKGWGQGSISS Q K+D+LD W+G Sbjct: 851 VQKGWGQGSISSLQPQKNDFLDYWEG 876 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 96.7 bits (239), Expect = 2e-18 Identities = 47/86 (54%), Positives = 59/86 (68%), Gaps = 2/86 (2%) Frame = +2 Query: 2 ADELSERMLEMPSEGKAQNKVCRDARAD--KKSKKYSESDWKAMVHRDDGSGTALKTLRR 175 ADEL+ERM+EM SE +NK + + + K + +DW +VHRDDGSG ALK L+R Sbjct: 787 ADELAERMMEMASESNKENKAYPNVKGHILRNKNKDAGNDWPIIVHRDDGSGIALKALKR 846 Query: 176 VQKGWGQGSISSFQLPKSDYLDDWDG 253 VQKGWGQGSISS Q K ++ D WDG Sbjct: 847 VQKGWGQGSISSLQPQKLEFFDYWDG 872 >ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329881|gb|EFH60300.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 874 Score = 93.6 bits (231), Expect = 1e-17 Identities = 46/85 (54%), Positives = 61/85 (71%), Gaps = 2/85 (2%) Frame = +2 Query: 2 ADELSERMLEMPSEGKAQNKVCRDARA--DKKSKKYSESDWKAMVHRDDGSGTALKTLRR 175 A+ +E+M+EM S G+ NKV +A KK KYS ++W+ ++HRDDGSG ALK+L R Sbjct: 787 ANNFAEKMMEMASVGEVANKVDPNATDIHQKKHNKYSGNNWQNILHRDDGSGIALKSLSR 846 Query: 176 VQKGWGQGSISSFQLPKSDYLDDWD 250 V+KGWGQG ISSFQ + DYLD W+ Sbjct: 847 VKKGWGQGDISSFQPQRVDYLDYWE 871 >ref|NP_179305.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122223754|sp|Q0WPZ6.1|PP158_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17140 gi|110737729|dbj|BAF00803.1| hypothetical protein [Arabidopsis thaliana] gi|330251496|gb|AEC06590.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 874 Score = 91.7 bits (226), Expect = 6e-17 Identities = 44/85 (51%), Positives = 61/85 (71%), Gaps = 2/85 (2%) Frame = +2 Query: 2 ADELSERMLEMPSEGKAQNKVCRDARA--DKKSKKYSESDWKAMVHRDDGSGTALKTLRR 175 A+ +++M+EM S G+ NKV +AR KK K ++W+ ++HRDDGSG AL++L R Sbjct: 787 ANSFADKMMEMASVGEVANKVDPNARDIHQKKHNKNGGNNWQNILHRDDGSGIALRSLSR 846 Query: 176 VQKGWGQGSISSFQLPKSDYLDDWD 250 V+KGWGQG ISSFQ P+ DYLD W+ Sbjct: 847 VKKGWGQGDISSFQPPRVDYLDYWE 871 >ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Glycine max] Length = 875 Score = 82.0 bits (201), Expect = 5e-14 Identities = 42/86 (48%), Positives = 60/86 (69%), Gaps = 2/86 (2%) Frame = +2 Query: 2 ADELSERMLEMPSEGKAQNKVCRDARADKKSK--KYSESDWKAMVHRDDGSGTALKTLRR 175 ADEL++RM+E+ E + ++ + + K K SDW+ +++RD GSG ALKTL+R Sbjct: 788 ADELAKRMMELELEDRPVDRTYSNRKRVIPGKLLKDGGSDWQDIINRDAGSGIALKTLKR 847 Query: 176 VQKGWGQGSISSFQLPKSDYLDDWDG 253 VQKGWGQGSISS Q ++D+LD +DG Sbjct: 848 VQKGWGQGSISSLQPQQNDFLDYYDG 873