BLASTX nr result
ID: Bupleurum21_contig00038825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038825 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527052.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002527052.1| conserved hypothetical protein [Ricinus communis] gi|223533614|gb|EEF35352.1| conserved hypothetical protein [Ricinus communis] Length = 170 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/97 (30%), Positives = 52/97 (53%) Frame = -1 Query: 454 AYASHIVRPAYRYLHRVLSHTLFGRGDSTGGVTQKELEVLYCMHHGVKLDFSSMLVERIG 275 A ++ I+ P R+++R ++T+ RGDS G V + E+ ++CM +K+ L + Sbjct: 20 AKSTSIIDPNLRHIYRWKAYTICARGDSFGIVQKTEVFFMHCMQKNIKVALGRFLASHLQ 79 Query: 274 TIVARTDGPILIGGFVTRIAERLGVFDRHKTNLVMIP 164 +I + + ILI VT+IA L VFD ++P Sbjct: 80 SITTQPNENILIRSLVTKIATYLKVFDPKDITFKLLP 116