BLASTX nr result
ID: Bupleurum21_contig00038771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038771 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN82528.1| hypothetical protein VITISV_028060 [Vitis vinifera] 62 5e-08 emb|CAN65075.1| hypothetical protein VITISV_008148 [Vitis vinifera] 62 5e-08 emb|CAN83046.1| hypothetical protein VITISV_015526 [Vitis vinifera] 61 1e-07 emb|CAN66268.1| hypothetical protein VITISV_003570 [Vitis vinifera] 61 1e-07 emb|CAN70763.1| hypothetical protein VITISV_028036 [Vitis vinifera] 61 1e-07 >emb|CAN82528.1| hypothetical protein VITISV_028060 [Vitis vinifera] Length = 549 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 9/76 (11%) Frame = -3 Query: 327 RPKNKNCAYHEDHGHDTEECRSLKYFLENLKQKGLLNHYL---------PRRPCPEMIQP 175 R +++ CA+H+DHGH TE CRS +Y +E L + G L YL P+ P ++ Sbjct: 260 RDRSRRCAFHKDHGHTTETCRSFQYLVERLIKAGHLKQYLRSDNGQRNAPQHHNPGNLRA 319 Query: 174 KEKPKNVVNVILGGES 127 PK+V+N I GG S Sbjct: 320 PAAPKDVINYITGGPS 335 >emb|CAN65075.1| hypothetical protein VITISV_008148 [Vitis vinifera] Length = 512 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 9/76 (11%) Frame = -3 Query: 327 RPKNKNCAYHEDHGHDTEECRSLKYFLENLKQKGLLNHYL---------PRRPCPEMIQP 175 R +++ CA+H+DHGH TE CRS +Y +E L + G L YL P+ P ++ Sbjct: 223 RDRSRRCAFHKDHGHTTETCRSFQYLVERLIKAGHLKQYLRSDNGRRDTPQHHNPGNLRA 282 Query: 174 KEKPKNVVNVILGGES 127 PK V+N I+GG S Sbjct: 283 PAAPKAVINYIIGGPS 298 >emb|CAN83046.1| hypothetical protein VITISV_015526 [Vitis vinifera] Length = 549 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 9/76 (11%) Frame = -3 Query: 327 RPKNKNCAYHEDHGHDTEECRSLKYFLENLKQKGLLNHYL---------PRRPCPEMIQP 175 R +++ CA+H+DHGH TE CRS +Y +E L + G L YL P+ P ++ Sbjct: 260 RDRSRRCAFHKDHGHTTETCRSFQYLVEKLIKAGHLKQYLRSDNGGRDAPQHHNPGNLRA 319 Query: 174 KEKPKNVVNVILGGES 127 PK V+N I GG S Sbjct: 320 PAAPKAVINYITGGPS 335 >emb|CAN66268.1| hypothetical protein VITISV_003570 [Vitis vinifera] Length = 512 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 9/76 (11%) Frame = -3 Query: 327 RPKNKNCAYHEDHGHDTEECRSLKYFLENLKQKGLLNHYL---------PRRPCPEMIQP 175 R +++ CA+H+DHGH TE CRS +Y +E L + G L YL P+ P ++ Sbjct: 223 RDRSRRCAFHKDHGHTTETCRSFQYLVERLIKAGHLKQYLRSDNGGRDAPQHHNPGNLRA 282 Query: 174 KEKPKNVVNVILGGES 127 PK V+N I GG S Sbjct: 283 PTAPKAVINYITGGPS 298 >emb|CAN70763.1| hypothetical protein VITISV_028036 [Vitis vinifera] Length = 506 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 9/76 (11%) Frame = -3 Query: 327 RPKNKNCAYHEDHGHDTEECRSLKYFLENLKQKGLLNHYL---------PRRPCPEMIQP 175 R +++ CA+H+DHGH TE CRS +Y +E L + G L YL P+ P ++ Sbjct: 217 RDRSRRCAFHKDHGHTTETCRSFQYLVERLIKAGHLKQYLRSDSGRRDTPQHHNPGNLRA 276 Query: 174 KEKPKNVVNVILGGES 127 PK V+N I GG S Sbjct: 277 PAAPKAVINYITGGPS 292