BLASTX nr result
ID: Bupleurum21_contig00038687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038687 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002865752.1| UDP-glucoronosyl/UDP-glucosyl transferase fa... 59 7e-08 ref|NP_199780.1| UDP-glycosyltransferase-like protein [Arabidops... 59 3e-07 ref|XP_002303861.1| predicted protein [Populus trichocarpa] gi|2... 51 2e-06 ref|XP_002527371.1| UDP-glucosyltransferase, putative [Ricinus c... 56 3e-06 ref|XP_002533517.1| UDP-glucosyltransferase, putative [Ricinus c... 48 4e-06 >ref|XP_002865752.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis lyrata subsp. lyrata] gi|297311587|gb|EFH42011.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis lyrata subsp. lyrata] Length = 515 Score = 58.9 bits (141), Expect(2) = 7e-08 Identities = 40/80 (50%), Positives = 46/80 (57%), Gaps = 3/80 (3%) Frame = -2 Query: 297 FFWVMR-EPLG*VAFTTTSQRVVELVSS*RTVHVGCVPQVKKLSHSAVGVFLTHYGWNFV 121 FFWV+R EP F E V VHVG VPQVK LSH +VG FLTH GWN V Sbjct: 305 FFWVLRNEPQIPDGFE-------ERVKGRGMVHVGWVPQVKILSHESVGGFLTHCGWNSV 357 Query: 120 IE--AFGV*PSFDTVPVMND 67 +E FG P F +PV+N+ Sbjct: 358 VEGIGFGKVPIF--LPVLNE 375 Score = 22.3 bits (46), Expect(2) = 7e-08 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -3 Query: 353 LSQEELGELAHGLECDGLPSF 291 L +EEL ELA GLE P F Sbjct: 286 LRREELTELALGLEKSETPFF 306 >ref|NP_199780.1| UDP-glycosyltransferase-like protein [Arabidopsis thaliana] gi|75264223|sp|Q9LTA3.1|U91C1_ARATH RecName: Full=UDP-glycosyltransferase 91C1 gi|8978266|dbj|BAA98157.1| anthocyanidin-3-glucoside rhamnosyltransferase-like [Arabidopsis thaliana] gi|26449402|dbj|BAC41828.1| putative anthocyanidin-3-glucoside rhamnosyltransferase [Arabidopsis thaliana] gi|28951061|gb|AAO63454.1| At5g49690 [Arabidopsis thaliana] gi|332008462|gb|AED95845.1| UDP-glycosyltransferase-like protein [Arabidopsis thaliana] Length = 460 Score = 58.5 bits (140), Expect(2) = 3e-07 Identities = 40/80 (50%), Positives = 45/80 (56%), Gaps = 3/80 (3%) Frame = -2 Query: 297 FFWVMR-EPLG*VAFTTTSQRVVELVSS*RTVHVGCVPQVKKLSHSAVGVFLTHYGWNFV 121 FFWV+R EP F T V VHVG VPQVK LSH +VG FLTH GWN V Sbjct: 306 FFWVLRNEPKIPDGFKTR-------VKGRGMVHVGWVPQVKILSHESVGGFLTHCGWNSV 358 Query: 120 IE--AFGV*PSFDTVPVMND 67 +E FG P F PV+N+ Sbjct: 359 VEGLGFGKVPIF--FPVLNE 376 Score = 20.8 bits (42), Expect(2) = 3e-07 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -3 Query: 353 LSQEELGELAHGLECDGLPSF 291 L EE+ ELA GLE P F Sbjct: 287 LRHEEVTELALGLEKSETPFF 307 >ref|XP_002303861.1| predicted protein [Populus trichocarpa] gi|222841293|gb|EEE78840.1| predicted protein [Populus trichocarpa] Length = 473 Score = 51.2 bits (121), Expect(2) = 2e-06 Identities = 29/79 (36%), Positives = 40/79 (50%), Gaps = 2/79 (2%) Frame = -2 Query: 297 FFWVMREPLG*V--AFTTTSQRVVELVSS*RTVHVGCVPQVKKLSHSAVGVFLTHYGWNF 124 FFWV+ + G A E V + +H G PQVK LSH +VG F+TH GWN Sbjct: 311 FFWVLNKIPGSTKNALDMLPDGFQERVKNRGIIHGGWAPQVKILSHDSVGGFMTHCGWNS 370 Query: 123 VIEAFGV*PSFDTVPVMND 67 +IE +P++N+ Sbjct: 371 IIEGLTFGRVLILLPILNE 389 Score = 25.0 bits (53), Expect(2) = 2e-06 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -3 Query: 353 LSQEELGELAHGLECDGLPSF 291 LS EEL ELA GLE LP F Sbjct: 292 LSGEELKELALGLENSTLPFF 312 >ref|XP_002527371.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223533290|gb|EEF35043.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 470 Score = 56.2 bits (134), Expect = 3e-06 Identities = 33/85 (38%), Positives = 43/85 (50%), Gaps = 8/85 (9%) Frame = -2 Query: 297 FFWVMREPLG*VAFTTTSQRVVEL--------VSS*RTVHVGCVPQVKKLSHSAVGVFLT 142 F WV++ P G T+Q +E+ V ++ G VPQVK LSH +VG FLT Sbjct: 309 FIWVLKNPPG------TTQNALEMLQDGYEERVKDRGMIYCGWVPQVKILSHESVGGFLT 362 Query: 141 HYGWNFVIEAFGV*PSFDTVPVMND 67 H GWN V+E PV+ND Sbjct: 363 HCGWNSVVEGLSFGRVLILFPVLND 387 >ref|XP_002533517.1| UDP-glucosyltransferase, putative [Ricinus communis] gi|223526614|gb|EEF28861.1| UDP-glucosyltransferase, putative [Ricinus communis] Length = 415 Score = 48.1 bits (113), Expect(2) = 4e-06 Identities = 27/69 (39%), Positives = 37/69 (53%), Gaps = 7/69 (10%) Frame = -2 Query: 297 FFWVMREPLG*VAFTTTSQRVVELVSS*R-------TVHVGCVPQVKKLSHSAVGVFLTH 139 FFWV+R+ G +T V+EL V G PQ+K L+H ++G FLTH Sbjct: 303 FFWVLRKRRG-----STDAEVIELPDGFEERTKGRGVVSTGWAPQLKILAHDSIGGFLTH 357 Query: 138 YGWNFVIEA 112 GW+ V+EA Sbjct: 358 SGWSSVVEA 366 Score = 27.3 bits (59), Expect(2) = 4e-06 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 359 GVLSQEELGELAHGLECDGLPSF 291 G SQ EL E+A GLE GLP F Sbjct: 282 GKPSQLELNEIALGLELSGLPFF 304