BLASTX nr result
ID: Bupleurum21_contig00038615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038615 (463 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002892416.1| pentatricopeptide repeat-containing protein ... 162 3e-38 ref|NP_172253.1| pentatricopeptide repeat-containing protein [Ar... 160 8e-38 emb|CBI16200.3| unnamed protein product [Vitis vinifera] 159 2e-37 ref|XP_002281474.1| PREDICTED: pentatricopeptide repeat-containi... 159 2e-37 ref|XP_002531100.1| pentatricopeptide repeat-containing protein,... 159 2e-37 >ref|XP_002892416.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338258|gb|EFH68675.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 459 Score = 162 bits (409), Expect = 3e-38 Identities = 78/129 (60%), Positives = 99/129 (76%), Gaps = 3/129 (2%) Frame = -2 Query: 378 HSPTHKPARKP---IPFLRDIKQIRDPDEALSLFYDYHNNLGFKHLYPSYSSLIYKLAKA 208 H PTHK RKP +PFL D+K+I DP+EALSLF+ Y +GF+H YPSYSSLIYKLAK+ Sbjct: 36 HEPTHKFTRKPWEEVPFLTDLKEIEDPEEALSLFHQYQE-MGFRHDYPSYSSLIYKLAKS 94 Query: 207 RNFDAVQTILHYIKSCNIRCDETLFIALFKHLGKANLIDNAVELFKNMKGFNCVRTVQSF 28 RNFDAV IL ++ N+RC E+LF+AL +H GKA +D AV++F + F+CVRT+QS Sbjct: 95 RNFDAVDQILRLVRYRNVRCRESLFMALIQHYGKAGWVDKAVDVFHKLTSFDCVRTIQSL 154 Query: 27 NTLLNVLVD 1 NTL+NVLVD Sbjct: 155 NTLINVLVD 163 >ref|NP_172253.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180186|sp|Q9LQQ1.1|PPR20_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g07740, mitochondrial; Flags: Precursor gi|8439893|gb|AAF75079.1|AC007583_15 It contains PPR repeats PF|01535 [Arabidopsis thaliana] gi|14596021|gb|AAK68738.1| Unknown protein [Arabidopsis thaliana] gi|31376389|gb|AAP49521.1| At1g07730 [Arabidopsis thaliana] gi|51970836|dbj|BAD44110.1| hypothetical protein [Arabidopsis thaliana] gi|332190050|gb|AEE28171.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 459 Score = 160 bits (406), Expect = 8e-38 Identities = 77/131 (58%), Positives = 99/131 (75%), Gaps = 3/131 (2%) Frame = -2 Query: 384 SHHSPTHKPARKP---IPFLRDIKQIRDPDEALSLFYDYHNNLGFKHLYPSYSSLIYKLA 214 S H PTHK RKP +PFL D+K+I DP+EALSLF+ Y +GF+H YPSYSSLIYKLA Sbjct: 34 SSHEPTHKFTRKPWEEVPFLTDLKEIEDPEEALSLFHQYQE-MGFRHDYPSYSSLIYKLA 92 Query: 213 KARNFDAVQTILHYIKSCNIRCDETLFIALFKHLGKANLIDNAVELFKNMKGFNCVRTVQ 34 K+RNFDAV IL ++ N+RC E+LF+ L +H GKA +D A+++F + F+CVRT+Q Sbjct: 93 KSRNFDAVDQILRLVRYRNVRCRESLFMGLIQHYGKAGSVDKAIDVFHKITSFDCVRTIQ 152 Query: 33 SFNTLLNVLVD 1 S NTL+NVLVD Sbjct: 153 SLNTLINVLVD 163 >emb|CBI16200.3| unnamed protein product [Vitis vinifera] Length = 1093 Score = 159 bits (403), Expect = 2e-37 Identities = 83/160 (51%), Positives = 111/160 (69%), Gaps = 11/160 (6%) Frame = -2 Query: 447 PRIYPIVIYYRLCAGNTYHS--------QSHHSPTHKPA---RKPIPFLRDIKQIRDPDE 301 PR++ I Y+ YH+ +S P H+ RK IPFL D+K ++DPD+ Sbjct: 410 PRLFRHFIEYK--PSQQYHTFRPRRPTTESRREPPHRSTSRLRKRIPFLADLKSVQDPDD 467 Query: 300 ALSLFYDYHNNLGFKHLYPSYSSLIYKLAKARNFDAVQTILHYIKSCNIRCDETLFIALF 121 ALSLF Y +GFKH YPSYS+L+YKLA++RNF+AV+T+L Y+++ NIRC ETLFIAL Sbjct: 468 ALSLFNQYQQ-MGFKHDYPSYSALVYKLARSRNFEAVETLLDYLQNINIRCRETLFIALI 526 Query: 120 KHLGKANLIDNAVELFKNMKGFNCVRTVQSFNTLLNVLVD 1 +H GK+ + + AVELF+ M FNC RT+ SFNTLLNVLV+ Sbjct: 527 QHYGKSQMPEKAVELFQRMPSFNCHRTLVSFNTLLNVLVE 566 >ref|XP_002281474.1| PREDICTED: pentatricopeptide repeat-containing protein At1g07740, mitochondrial-like [Vitis vinifera] Length = 501 Score = 159 bits (403), Expect = 2e-37 Identities = 83/160 (51%), Positives = 111/160 (69%), Gaps = 11/160 (6%) Frame = -2 Query: 447 PRIYPIVIYYRLCAGNTYHS--------QSHHSPTHKPA---RKPIPFLRDIKQIRDPDE 301 PR++ I Y+ YH+ +S P H+ RK IPFL D+K ++DPD+ Sbjct: 48 PRLFRHFIEYK--PSQQYHTFRPRRPTTESRREPPHRSTSRLRKRIPFLADLKSVQDPDD 105 Query: 300 ALSLFYDYHNNLGFKHLYPSYSSLIYKLAKARNFDAVQTILHYIKSCNIRCDETLFIALF 121 ALSLF Y +GFKH YPSYS+L+YKLA++RNF+AV+T+L Y+++ NIRC ETLFIAL Sbjct: 106 ALSLFNQYQQ-MGFKHDYPSYSALVYKLARSRNFEAVETLLDYLQNINIRCRETLFIALI 164 Query: 120 KHLGKANLIDNAVELFKNMKGFNCVRTVQSFNTLLNVLVD 1 +H GK+ + + AVELF+ M FNC RT+ SFNTLLNVLV+ Sbjct: 165 QHYGKSQMPEKAVELFQRMPSFNCHRTLVSFNTLLNVLVE 204 >ref|XP_002531100.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529296|gb|EEF31265.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 483 Score = 159 bits (403), Expect = 2e-37 Identities = 74/130 (56%), Positives = 101/130 (77%) Frame = -2 Query: 390 SQSHHSPTHKPARKPIPFLRDIKQIRDPDEALSLFYDYHNNLGFKHLYPSYSSLIYKLAK 211 +Q H T + R+ IPF+ ++K++ DPD+ALSLF+DY N GF+H YPSYS+L+YKLA+ Sbjct: 35 NQKHQHFTRRQ-RRDIPFVNNVKEVEDPDKALSLFHDYLQN-GFRHDYPSYSALVYKLAR 92 Query: 210 ARNFDAVQTILHYIKSCNIRCDETLFIALFKHLGKANLIDNAVELFKNMKGFNCVRTVQS 31 +R F+AV+T+L Y++ N+RC +TLFIALF+H GK L+ A+ LF M GFNC+RT+QS Sbjct: 93 SRRFEAVETVLGYLQDFNVRCRDTLFIALFEHYGKVGLVAKAIRLFNEMTGFNCIRTLQS 152 Query: 30 FNTLLNVLVD 1 FN LLNVLVD Sbjct: 153 FNALLNVLVD 162