BLASTX nr result
ID: Bupleurum21_contig00038599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038599 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527233.1| kinase, putative [Ricinus communis] gi|22353... 39 9e-06 >ref|XP_002527233.1| kinase, putative [Ricinus communis] gi|223533409|gb|EEF35159.1| kinase, putative [Ricinus communis] Length = 652 Score = 38.9 bits (89), Expect(3) = 9e-06 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = -1 Query: 126 AGPRRVSYQSLAVATKNFLDEQKLGKG 46 AGPRR SY+ L AT NF +E+ LGKG Sbjct: 325 AGPRRFSYEDLVAATNNFSNERMLGKG 351 Score = 29.6 bits (65), Expect(3) = 9e-06 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 44 KGGFGCVYKGHLLD 3 KGGFG VYKG+L+D Sbjct: 350 KGGFGAVYKGYLID 363 Score = 24.6 bits (52), Expect(3) = 9e-06 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -3 Query: 217 IVWFRRRRCIAGKAAESAHNLTTISVDIAKSRAQKSF 107 I++F RR+ + + E NLT+I+ D+ + + F Sbjct: 294 ILFFWRRKKMMKRKGEEKMNLTSINKDLERGAGPRRF 330