BLASTX nr result
ID: Bupleurum21_contig00038444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038444 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604155.1| hypothetical protein MTR_4g006050 [Medicago ... 113 1e-27 ref|XP_003610226.1| hypothetical protein MTR_4g129350 [Medicago ... 113 1e-27 ref|XP_003599575.1| hypothetical protein MTR_3g035630 [Medicago ... 113 1e-27 ref|XP_003616486.1| hypothetical protein MTR_5g080920 [Medicago ... 110 2e-26 ref|XP_003550191.1| PREDICTED: uncharacterized protein LOC100779... 115 5e-24 >ref|XP_003604155.1| hypothetical protein MTR_4g006050 [Medicago truncatula] gi|355505210|gb|AES86352.1| hypothetical protein MTR_4g006050 [Medicago truncatula] Length = 169 Score = 113 bits (283), Expect(2) = 1e-27 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 199 ESFSGMFRSFSPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP 29 +SFSGMFRS PLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP Sbjct: 80 QSFSGMFRSSFPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP 136 Score = 34.3 bits (77), Expect(2) = 1e-27 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 321 DEGTLGEXXXXXTVHVRSILDLTN 250 DE TLGE TVHVRSILDLTN Sbjct: 56 DEETLGEPPTPTTVHVRSILDLTN 79 >ref|XP_003610226.1| hypothetical protein MTR_4g129350 [Medicago truncatula] gi|355511281|gb|AES92423.1| hypothetical protein MTR_4g129350 [Medicago truncatula] Length = 158 Score = 113 bits (283), Expect(2) = 1e-27 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 199 ESFSGMFRSFSPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP 29 +SFSGMFRS PLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP Sbjct: 69 QSFSGMFRSSFPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP 125 Score = 34.3 bits (77), Expect(2) = 1e-27 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 321 DEGTLGEXXXXXTVHVRSILDLTN 250 DE TLGE TVHVRSILDLTN Sbjct: 45 DEETLGEPPTPTTVHVRSILDLTN 68 >ref|XP_003599575.1| hypothetical protein MTR_3g035630 [Medicago truncatula] gi|355488623|gb|AES69826.1| hypothetical protein MTR_3g035630 [Medicago truncatula] Length = 152 Score = 113 bits (283), Expect(2) = 1e-27 Identities = 54/57 (94%), Positives = 55/57 (96%) Frame = -1 Query: 199 ESFSGMFRSFSPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP 29 +SFSGMFRS PLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP Sbjct: 63 QSFSGMFRSSFPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPP 119 Score = 34.3 bits (77), Expect(2) = 1e-27 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 321 DEGTLGEXXXXXTVHVRSILDLTN 250 DE TLGE TVHVRSILDLTN Sbjct: 39 DEETLGEPPTPTTVHVRSILDLTN 62 >ref|XP_003616486.1| hypothetical protein MTR_5g080920 [Medicago truncatula] gi|355517821|gb|AES99444.1| hypothetical protein MTR_5g080920 [Medicago truncatula] Length = 125 Score = 110 bits (274), Expect(2) = 2e-26 Identities = 53/63 (84%), Positives = 57/63 (90%) Frame = -1 Query: 199 ESFSGMFRSFSPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPPSQV 20 +SFSGMFRS PLLRKSEP VQVQDTIITAW IRHPTRNRNDPIAR ELYQLSYIP +++ Sbjct: 63 QSFSGMFRSSFPLLRKSEPLVQVQDTIITAWIIRHPTRNRNDPIARVELYQLSYIPRAKL 122 Query: 19 EHA 11 EHA Sbjct: 123 EHA 125 Score = 34.3 bits (77), Expect(2) = 2e-26 Identities = 18/24 (75%), Positives = 18/24 (75%) Frame = -2 Query: 321 DEGTLGEXXXXXTVHVRSILDLTN 250 DE TLGE TVHVRSILDLTN Sbjct: 39 DEETLGEPPTPTTVHVRSILDLTN 62 >ref|XP_003550191.1| PREDICTED: uncharacterized protein LOC100779489 [Glycine max] gi|255631262|gb|ACU15998.1| unknown [Glycine max] Length = 58 Score = 115 bits (287), Expect = 5e-24 Identities = 55/58 (94%), Positives = 56/58 (96%) Frame = -1 Query: 184 MFRSFSPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPPSQVEHA 11 MFRS PLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPPS+VEHA Sbjct: 1 MFRSSFPLLRKSEPPVQVQDTIITAWTIRHPTRNRNDPIARAELYQLSYIPPSRVEHA 58