BLASTX nr result
ID: Bupleurum21_contig00038433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038433 (366 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28351.3| unnamed protein product [Vitis vinifera] 92 6e-17 ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 ref|XP_002306231.1| predicted protein [Populus trichocarpa] gi|2... 91 1e-16 ref|XP_002961361.1| hypothetical protein SELMODRAFT_76175 [Selag... 87 2e-15 ref|XP_002980913.1| hypothetical protein SELMODRAFT_113567 [Sela... 87 2e-15 >emb|CBI28351.3| unnamed protein product [Vitis vinifera] Length = 770 Score = 91.7 bits (226), Expect = 6e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 2 RVCGDCHTVIKLISSLEGREIVVRDSNRFHHFKGGFCSCGEYW 130 RVCGDCHTVIKLIS +EGR+IVVRDSNRFHHFKGG CSCG+YW Sbjct: 728 RVCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 770 >ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Vitis vinifera] Length = 866 Score = 91.7 bits (226), Expect = 6e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 2 RVCGDCHTVIKLISSLEGREIVVRDSNRFHHFKGGFCSCGEYW 130 RVCGDCHTVIKLIS +EGR+IVVRDSNRFHHFKGG CSCG+YW Sbjct: 824 RVCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 866 >ref|XP_002306231.1| predicted protein [Populus trichocarpa] gi|222849195|gb|EEE86742.1| predicted protein [Populus trichocarpa] Length = 480 Score = 90.9 bits (224), Expect = 1e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 2 RVCGDCHTVIKLISSLEGREIVVRDSNRFHHFKGGFCSCGEYW 130 RVCGDCH+VIKLIS LEGR+IVVRDSNRFHHFKGG CSCG+YW Sbjct: 438 RVCGDCHSVIKLISILEGRDIVVRDSNRFHHFKGGLCSCGDYW 480 >ref|XP_002961361.1| hypothetical protein SELMODRAFT_76175 [Selaginella moellendorffii] gi|300170020|gb|EFJ36621.1| hypothetical protein SELMODRAFT_76175 [Selaginella moellendorffii] Length = 1121 Score = 86.7 bits (213), Expect = 2e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +2 Query: 2 RVCGDCHTVIKLISSLEGREIVVRDSNRFHHFKGGFCSCGEYW 130 R CGDCHT IKLIS++EGREIVVRDSNRFHHF+ G CSCG+YW Sbjct: 1079 RACGDCHTAIKLISAIEGREIVVRDSNRFHHFRNGSCSCGDYW 1121 >ref|XP_002980913.1| hypothetical protein SELMODRAFT_113567 [Selaginella moellendorffii] gi|300151452|gb|EFJ18098.1| hypothetical protein SELMODRAFT_113567 [Selaginella moellendorffii] Length = 809 Score = 86.7 bits (213), Expect = 2e-15 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +2 Query: 2 RVCGDCHTVIKLISSLEGREIVVRDSNRFHHFKGGFCSCGEYW 130 R CGDCHT IKLIS++EGREIVVRDSNRFHHF+ G CSCG+YW Sbjct: 767 RACGDCHTAIKLISAIEGREIVVRDSNRFHHFRNGSCSCGDYW 809