BLASTX nr result
ID: Bupleurum21_contig00038327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038327 (374 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629505.1| Zinc finger MYM-type protein [Medicago trunc... 102 3e-20 ref|XP_002446342.1| hypothetical protein SORBIDRAFT_06g014508 [S... 100 1e-19 ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the pro... 100 2e-19 dbj|BAA36225.1| transposase [Ipomoea purpurea] 99 3e-19 ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the pro... 99 5e-19 >ref|XP_003629505.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355523527|gb|AET03981.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 821 Score = 102 bits (254), Expect = 3e-20 Identities = 51/98 (52%), Positives = 66/98 (67%), Gaps = 1/98 (1%) Frame = -1 Query: 296 SNNQPTPVSTMNSEQIEVDITSLERDPGLRLPIWKYPSNVRDEIRRAYIKLGPYQPTMDR 117 + + P+ ++ ++ E IE+ LERDPG R+PIWKYP D IRRAY+K GPYQ + Sbjct: 122 NESHPSKINRVDPEDIEI---FLERDPGKRIPIWKYPPKQMDAIRRAYLKWGPYQSNL-- 176 Query: 116 EKYPATVFGSQRRRFQCSWFNQF-PWLEYSVSKDAAFC 6 E YP + G +RRFQ SWF+ F WLEYS SKDAA+C Sbjct: 177 ENYPMSGIGKAQRRFQHSWFSLFSSWLEYSPSKDAAYC 214 >ref|XP_002446342.1| hypothetical protein SORBIDRAFT_06g014508 [Sorghum bicolor] gi|241937525|gb|EES10670.1| hypothetical protein SORBIDRAFT_06g014508 [Sorghum bicolor] Length = 629 Score = 100 bits (250), Expect = 1e-19 Identities = 51/124 (41%), Positives = 68/124 (54%), Gaps = 1/124 (0%) Frame = -1 Query: 371 QPMSNVDAPDTLMPSTNEQTTSNAASNNQPTPVSTMNSEQIEV-DITSLERDPGLRLPIW 195 Q NV T+ P N ++ P++ NS + D+ ++ DPGLR+PI Sbjct: 41 QQNDNVTGTSTIPPEPEVTAEPNVIEEDEALPLNKSNSSDEGIGDMYQIQHDPGLRVPIS 100 Query: 194 KYPSNVRDEIRRAYIKLGPYQPTMDREKYPATVFGSQRRRFQCSWFNQFPWLEYSVSKDA 15 Y N +D +RRAYI LGP +P M + +P G RRF WFN+F WLEYSV KDA Sbjct: 101 SYDVNDQDSVRRAYIALGPCRPKMKKNDFPQHETGGM-RRFNRKWFNEFNWLEYSVQKDA 159 Query: 14 AFCF 3 A+CF Sbjct: 160 AYCF 163 >ref|XP_003614463.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355515798|gb|AES97421.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 796 Score = 99.8 bits (247), Expect = 2e-19 Identities = 49/98 (50%), Positives = 69/98 (70%), Gaps = 1/98 (1%) Frame = -1 Query: 296 SNNQPTPVSTMNSEQIEVDITSLERDPGLRLPIWKYPSNVRDEIRRAYIKLGPYQPTMDR 117 + ++P+ ++ ++ + IE SLERDPG R+PI++YP N +D IRRAY+K GPYQ + Sbjct: 41 NESRPSKINRVDPDDIE---NSLERDPGKRIPIYQYPPNQKDAIRRAYLKWGPYQSNL-- 95 Query: 116 EKYPATVFGSQRRRFQCSWFNQF-PWLEYSVSKDAAFC 6 E YP + G +RRFQ SWF+ F WLEYS S+DAA+C Sbjct: 96 ENYPMSGIGKAQRRFQHSWFSLFSSWLEYSPSEDAAYC 133 >dbj|BAA36225.1| transposase [Ipomoea purpurea] Length = 808 Score = 99.4 bits (246), Expect = 3e-19 Identities = 57/99 (57%), Positives = 64/99 (64%), Gaps = 3/99 (3%) Frame = -1 Query: 293 NNQPTPVSTMNSEQIE-VDITSLERDPGLRLPIWKYPSNVRDEIRRAYIKLGPYQPTMDR 117 N++ P E E DI +LERDPGLRLPIWK P RDE+RRAYIK GPYQ + Sbjct: 33 NSESRPEKAQRVEINEKFDIQALERDPGLRLPIWKCPIEKRDEVRRAYIKAGPYQCLL-- 90 Query: 116 EKYPATVFGSQR-RRFQCSWFNQFP-WLEYSVSKDAAFC 6 KYP + G + R FQ SWF FP WLEYS SKDAAFC Sbjct: 91 SKYPKS--GEKHPRSFQASWFKLFPSWLEYSPSKDAAFC 127 >ref|XP_003602139.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] gi|355491187|gb|AES72390.1| 52 kDa repressor of the inhibitor of the protein kinase [Medicago truncatula] Length = 785 Score = 98.6 bits (244), Expect = 5e-19 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 1/94 (1%) Frame = -1 Query: 284 PTPVSTMNSEQIEVDITSLERDPGLRLPIWKYPSNVRDEIRRAYIKLGPYQPTMDREKYP 105 P+ ++ ++ + IE SLERDPG R+PI++YP N +D IRRAY+K GPYQ + E YP Sbjct: 8 PSKINRVDPDDIE---NSLERDPGKRIPIYQYPPNQKDAIRRAYLKWGPYQSNL--ENYP 62 Query: 104 ATVFGSQRRRFQCSWFNQF-PWLEYSVSKDAAFC 6 + G +RRFQ SWF+ F WLEYS S+DAA+C Sbjct: 63 MSGIGKAQRRFQHSWFSLFSSWLEYSPSEDAAYC 96