BLASTX nr result
ID: Bupleurum21_contig00038057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00038057 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528358.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_003536260.1| PREDICTED: oxidation resistance protein 1-li... 56 3e-06 >ref|XP_002528358.1| conserved hypothetical protein [Ricinus communis] gi|223532226|gb|EEF34030.1| conserved hypothetical protein [Ricinus communis] Length = 339 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/65 (47%), Positives = 43/65 (66%), Gaps = 6/65 (9%) Frame = +2 Query: 164 MYSLKDKVSDKLSHLFSDSP------STPKQPQATEYSKGGRSVSAIFSYILPSTSSNGF 325 M+SLKDKVS++LS +F+DSP S P QA +S GG+S S+ FS+ +PS + G Sbjct: 1 MHSLKDKVSNQLSRIFADSPNHNSPSSPPDNSQARPFSSGGKSFSSYFSFGVPSLNFGGS 60 Query: 326 QSNNQ 340 +SN Q Sbjct: 61 KSNKQ 65 >ref|XP_003536260.1| PREDICTED: oxidation resistance protein 1-like [Glycine max] Length = 312 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +2 Query: 164 MYSLKDKVSDKLSHLFSDSPSTPKQPQATEYSKGGRSVSAIFSYILPSTSSNGFQSN 334 MYS KDKV+ KLSHLF +S S+ PQ + YS+ + +S+ SYI+PS S +G +SN Sbjct: 1 MYSFKDKVTQKLSHLFPNSSSS--SPQDSPYSQEDKPLSSYLSYIIPSISFDGSKSN 55