BLASTX nr result
ID: Bupleurum21_contig00037986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037986 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK79037.1| glycosyltransferase UGT5 [Bupleurum chinense] 165 2e-41 ref|XP_002265392.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucur... 60 1e-07 dbj|BAF99027.1| UDP-glucose:sesaminol 2'-O-glucoside-O-glucosylt... 59 4e-07 sp|Q5NTH0.1|UGAT_BELPE RecName: Full=Cyanidin-3-O-glucoside 2-O-... 59 4e-07 gb|AEJ88222.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Pr... 57 1e-06 >gb|AFK79037.1| glycosyltransferase UGT5 [Bupleurum chinense] Length = 456 Score = 165 bits (418), Expect(2) = 2e-41 Identities = 82/89 (92%), Positives = 84/89 (94%), Gaps = 1/89 (1%) Frame = -2 Query: 266 TAAANFCLFLYFCKNPNEDSSFPEIYVRNSENPPTERSHPVIRNMVLCFERSTDLVLVKS 87 TAAANFCLFL+FCKNP+EDS FPEIYVRNSENPPTERSHPVIRNMVLCFERSTDLVLVKS Sbjct: 144 TAAANFCLFLFFCKNPDEDSPFPEIYVRNSENPPTERSHPVIRNMVLCFERSTDLVLVKS 203 Query: 86 CREVEAKYI-HLLSDLATKKVIPVGPLVE 3 CREVE KYI HL S LATKKVIPVGPLVE Sbjct: 204 CREVEGKYIDHLSSVLATKKVIPVGPLVE 232 Score = 28.5 bits (62), Expect(2) = 2e-41 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 316 QVALSLNIPAVFF 278 QVALSLNIPAVFF Sbjct: 129 QVALSLNIPAVFF 141 >ref|XP_002265392.1| PREDICTED: cyanidin-3-O-glucoside 2-O-glucuronosyltransferase-like [Vitis vinifera] Length = 491 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/93 (34%), Positives = 52/93 (55%), Gaps = 7/93 (7%) Frame = -2 Query: 260 AANFCLFLYFCKNPNEDSSFPEIYVRNSENPPTERSHPVIRNMVL-------CFERSTDL 102 AA ++F K P + FPEIY+R+ E R N C E+S+++ Sbjct: 145 AAATAFMIHFVKKPGNEFPFPEIYLRDYETSGFNRFVESSANARKDKEKARQCLEQSSNV 204 Query: 101 VLVKSCREVEAKYIHLLSDLATKKVIPVGPLVE 3 +L++S +E+E ++I LS+L K V+PVGPL++ Sbjct: 205 ILIRSFKEIEERFIDFLSNLNAKTVVPVGPLLQ 237 >dbj|BAF99027.1| UDP-glucose:sesaminol 2'-O-glucoside-O-glucosyltransferase [Sesamum indicum] Length = 469 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/99 (36%), Positives = 54/99 (54%), Gaps = 6/99 (6%) Frame = -2 Query: 281 FYNIITAAANFCLFLYFCKNPNEDSSFPEIYVRNSENP------PTERSHPVIRNMVLCF 120 F + AA +F ++ +F P E+ FP IY R E ++ + C Sbjct: 138 FLSTGAAAISFIMYHWFETRP-EEYPFPAIYFREHEYDNFCRFKSSDSGTSDQLRVSDCV 196 Query: 119 ERSTDLVLVKSCREVEAKYIHLLSDLATKKVIPVGPLVE 3 +RS DLVL+K+ RE+E +Y+ LSDL K+ +PVGPLV+ Sbjct: 197 KRSHDLVLIKTFRELEGQYVDFLSDLTRKRFVPVGPLVQ 235 >sp|Q5NTH0.1|UGAT_BELPE RecName: Full=Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase; Short=BpUGAT; AltName: Full=UDP-glucuronic acid:anthocyanin glucuronosyltransferase gi|56550539|dbj|BAD77944.1| UDP-glucuronic acid:anthocyanin glucuronosyltransferase [Bellis perennis] Length = 438 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/67 (46%), Positives = 41/67 (61%) Frame = -2 Query: 203 FPEIYVRNSENPPTERSHPVIRNMVLCFERSTDLVLVKSCREVEAKYIHLLSDLATKKVI 24 FPEIY +N + P + I V C RS +++LV+S E+E KYI LS KKV+ Sbjct: 169 FPEIYPKNRDIPKGGSKY--IERFVDCMRRSCEIILVRSTMELEGKYIDYLSKTLGKKVL 226 Query: 23 PVGPLVE 3 PVGPLV+ Sbjct: 227 PVGPLVQ 233 >gb|AEJ88222.1| UDP-glucose:flavonoid 3-O-glucosyltransferase [Prunus persica] Length = 456 Score = 57.4 bits (137), Expect = 1e-06 Identities = 38/96 (39%), Positives = 54/96 (56%), Gaps = 8/96 (8%) Frame = -2 Query: 266 TAAANFCLF-LYFCKNPNEDSSFPEIYVRNSE----NPPTERSHPVIRN---MVLCFERS 111 T A F F + KNP+ FP IY+++ E N E S I++ + C RS Sbjct: 145 TMGAAFTSFSIQHLKNPSVKFPFPSIYLQHYEAEKFNNLLESSANGIKDGDRVQQCSARS 204 Query: 110 TDLVLVKSCREVEAKYIHLLSDLATKKVIPVGPLVE 3 +++LVK+ E+E KYI LSDL KK++PVG LV+ Sbjct: 205 CNIILVKTSSEIEEKYIDYLSDLTGKKIVPVGTLVQ 240