BLASTX nr result
ID: Bupleurum21_contig00037599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037599 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511978.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002511978.1| conserved hypothetical protein [Ricinus communis] gi|223549158|gb|EEF50647.1| conserved hypothetical protein [Ricinus communis] Length = 315 Score = 55.5 bits (132), Expect = 5e-06 Identities = 39/126 (30%), Positives = 59/126 (46%), Gaps = 18/126 (14%) Frame = +3 Query: 6 RAKERTKEKK------------QQLNDQQSTSLMTWNPYGAGKHLVGTSHHTLN----YK 137 RA++RT+EKK Q+ DQ+ L TW+P+ GT HT+N + Sbjct: 181 RARQRTEEKKRTRRIIDVPNLCQEAKDQELNQLRTWSPFETTGEESGTQSHTMNNNPSME 240 Query: 138 GLVHTEELQYTKEQQMQNQGIRVESITIGDPNFFLNGDWSPSTLFNYQQPSGISHE--NQ 311 L EE + Q Q+Q + E + D + + G WSPS + N+ + I E +Q Sbjct: 241 MLAEIEEAPISSHVQQQDQLVTTEGMI--DDSLVIMGKWSPSFIINHLFNTSIPQETNHQ 298 Query: 312 PTDFRS 329 TD +S Sbjct: 299 ITDLQS 304