BLASTX nr result
ID: Bupleurum21_contig00037508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037508 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324074.1| predicted protein [Populus trichocarpa] gi|2... 101 7e-20 ref|XP_002278719.1| PREDICTED: pentatricopeptide repeat-containi... 98 6e-19 ref|XP_002873720.1| pentatricopeptide repeat-containing protein ... 95 5e-18 ref|NP_197038.1| pentatricopeptide repeat-containing protein [Ar... 95 5e-18 ref|XP_003554900.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-17 >ref|XP_002324074.1| predicted protein [Populus trichocarpa] gi|222867076|gb|EEF04207.1| predicted protein [Populus trichocarpa] Length = 636 Score = 101 bits (251), Expect = 7e-20 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 2 PLYIFKNLRICQDCHSAFKIISSVYNREIVMRDRNRFHKFKQGICSCSDYW 154 PLYIFKNLRICQDCHSA KI+S +YNREIV+RDRNRFH FK G CSCSDYW Sbjct: 586 PLYIFKNLRICQDCHSAIKIVSKIYNREIVIRDRNRFHCFKHGSCSCSDYW 636 >ref|XP_002278719.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Vitis vinifera] Length = 632 Score = 98.2 bits (243), Expect = 6e-19 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +2 Query: 2 PLYIFKNLRICQDCHSAFKIISSVYNREIVMRDRNRFHKFKQGICSCSDYW 154 PL+IFKNLRICQDCHSA KI+S +YNREIV+RDRNRFH FK+G CSC DYW Sbjct: 582 PLHIFKNLRICQDCHSAIKIVSKIYNREIVIRDRNRFHCFKEGSCSCCDYW 632 >ref|XP_002873720.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319557|gb|EFH49979.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 623 Score = 95.1 bits (235), Expect = 5e-18 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +2 Query: 2 PLYIFKNLRICQDCHSAFKIISSVYNREIVMRDRNRFHKFKQGICSCSDYW 154 PL +FKNLRIC+DCHSA KI+S VY+REI++RDRNRFH+FK G CSCSDYW Sbjct: 573 PLLVFKNLRICRDCHSAMKIVSKVYDREIIIRDRNRFHQFKGGSCSCSDYW 623 >ref|NP_197038.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180838|sp|Q9LXE8.1|PP386_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15340, mitochondrial; Flags: Precursor gi|7671503|emb|CAB89344.1| putative protein [Arabidopsis thaliana] gi|332004768|gb|AED92151.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 623 Score = 95.1 bits (235), Expect = 5e-18 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = +2 Query: 2 PLYIFKNLRICQDCHSAFKIISSVYNREIVMRDRNRFHKFKQGICSCSDYW 154 PL +FKNLRIC+DCHSA KI+S VY+REI++RDRNRFH+FK G CSCSDYW Sbjct: 573 PLLVFKNLRICRDCHSAMKIVSKVYDREIIIRDRNRFHQFKGGSCSCSDYW 623 >ref|XP_003554900.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Glycine max] Length = 629 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/51 (80%), Positives = 43/51 (84%) Frame = +2 Query: 2 PLYIFKNLRICQDCHSAFKIISSVYNREIVMRDRNRFHKFKQGICSCSDYW 154 PL IFKNLRICQDCHSA KI S +Y REIV+RDR RFH FKQG CSCSDYW Sbjct: 579 PLCIFKNLRICQDCHSAIKIASDIYKREIVVRDRYRFHSFKQGSCSCSDYW 629