BLASTX nr result
ID: Bupleurum21_contig00037257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00037257 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW74633.1| hypothetical protein ZEAMMB73_204913 [Zea mays] 58 9e-07 gb|AFW82750.1| hypothetical protein ZEAMMB73_878123 [Zea mays] 55 6e-06 >gb|AFW74633.1| hypothetical protein ZEAMMB73_204913 [Zea mays] Length = 288 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/37 (64%), Positives = 32/37 (86%) Frame = +1 Query: 232 DNLNALIRDGDVACKSELRMNRQTFYVLCEMVRDIGG 342 +NLN LIR+ D C SELRM+R+TF++LCEM+RD+GG Sbjct: 2 ENLNGLIRESDRKCISELRMDRRTFFILCEMLRDVGG 38 >gb|AFW82750.1| hypothetical protein ZEAMMB73_878123 [Zea mays] Length = 445 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +1 Query: 232 DNLNALIRDGDVACKSELRMNRQTFYVLCEMVRDIGG 342 +NLN LIR+ D C SELRM+ +TF++LCEM+RD+GG Sbjct: 2 ENLNELIRESDRKCISELRMDTRTFFILCEMLRDVGG 38