BLASTX nr result
ID: Bupleurum21_contig00036178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036178 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263663.2| PREDICTED: sister chromatid cohesion 1 prote... 58 7e-07 emb|CBI24843.3| unnamed protein product [Vitis vinifera] 58 7e-07 gb|AAG44843.1|AF281155_1 cohesion family protein SYN3 [Arabidops... 57 2e-06 ref|NP_191514.1| Sister chromatid cohesion 1 protein 3 [Arabidop... 57 2e-06 >ref|XP_002263663.2| PREDICTED: sister chromatid cohesion 1 protein 3-like [Vitis vinifera] Length = 761 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/56 (42%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = +3 Query: 3 KIKKDTIFVEPLVTGLCDDLREAYKKDFVSSKPHLSLVEETCPQ--VAETSAPMDD 164 K +K+ +F EP VTG+C+DL +++D +S KPHL++ E+ P+ VA++ APM + Sbjct: 430 KSRKENVFFEPSVTGMCEDLHNTFREDVISLKPHLAITEQAFPEPLVAQSPAPMPE 485 >emb|CBI24843.3| unnamed protein product [Vitis vinifera] Length = 709 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/56 (42%), Positives = 40/56 (71%), Gaps = 2/56 (3%) Frame = +3 Query: 3 KIKKDTIFVEPLVTGLCDDLREAYKKDFVSSKPHLSLVEETCPQ--VAETSAPMDD 164 K +K+ +F EP VTG+C+DL +++D +S KPHL++ E+ P+ VA++ APM + Sbjct: 406 KSRKENVFFEPSVTGMCEDLHNTFREDVISLKPHLAITEQAFPEPLVAQSPAPMPE 461 >gb|AAG44843.1|AF281155_1 cohesion family protein SYN3 [Arabidopsis thaliana] Length = 692 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = +3 Query: 9 KKDTIFVEPLVTGLCDDLREAYKKDFVSSKPHLSLVEETCPQVAETS 149 +KD F EPL TG DDLR ++KD+V+SKPHL++ +ET P+ A S Sbjct: 402 RKDQNFNEPLFTGFSDDLRNVFEKDYVASKPHLAVSDETLPEPASVS 448 >ref|NP_191514.1| Sister chromatid cohesion 1 protein 3 [Arabidopsis thaliana] gi|30913284|sp|Q9FQ19.2|SCC13_ARATH RecName: Full=Sister chromatid cohesion 1 protein 3; AltName: Full=SCC1 homolog 3; Short=AtRAD21-2 gi|18157647|gb|AAL62059.1|AF400128_1 RAD21-2 [Arabidopsis thaliana] gi|6996291|emb|CAB75452.1| putative protein [Arabidopsis thaliana] gi|332646418|gb|AEE79939.1| Sister chromatid cohesion 1 protein 3 [Arabidopsis thaliana] Length = 693 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = +3 Query: 9 KKDTIFVEPLVTGLCDDLREAYKKDFVSSKPHLSLVEETCPQVAETS 149 +KD F EPL TG DDLR ++KD+V+SKPHL++ +ET P+ A S Sbjct: 403 RKDQNFNEPLFTGFSDDLRNVFEKDYVASKPHLAVSDETLPEPASVS 449