BLASTX nr result
ID: Bupleurum21_contig00036017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00036017 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283083.2| PREDICTED: uncharacterized protein LOC100249... 68 7e-10 emb|CBI21108.3| unnamed protein product [Vitis vinifera] 68 7e-10 >ref|XP_002283083.2| PREDICTED: uncharacterized protein LOC100249152 [Vitis vinifera] Length = 708 Score = 68.2 bits (165), Expect = 7e-10 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +3 Query: 111 MESSSAKESMNSGSSAALCSEATIEIKIKAPDSQTYTMRVDNCMPVNALMDQL 269 M S+ E M SGS A CSEAT+EIKIK DSQTYT+RVD CMPV AL +Q+ Sbjct: 1 MGSTGGDEVMISGSGEAQCSEATVEIKIKTLDSQTYTLRVDKCMPVPALKEQI 53 >emb|CBI21108.3| unnamed protein product [Vitis vinifera] Length = 573 Score = 68.2 bits (165), Expect = 7e-10 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +3 Query: 111 MESSSAKESMNSGSSAALCSEATIEIKIKAPDSQTYTMRVDNCMPVNALMDQL 269 M S+ E M SGS A CSEAT+EIKIK DSQTYT+RVD CMPV AL +Q+ Sbjct: 1 MGSTGGDEVMISGSGEAQCSEATVEIKIKTLDSQTYTLRVDKCMPVPALKEQI 53