BLASTX nr result
ID: Bupleurum21_contig00035906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00035906 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517025.1| pentatricopeptide repeat-containing protein,... 67 2e-09 ref|XP_002280144.2| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 emb|CBI26355.3| unnamed protein product [Vitis vinifera] 65 4e-09 >ref|XP_002517025.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543660|gb|EEF45188.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 640 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +2 Query: 86 GSVNSSDPVLNKILRFYCRFAETHYAQKVFDGVPEPNSFMWTSMIHG 226 GS+ SSD LNK+LR Y +F YA K+FD PEPNSF+WT++IHG Sbjct: 30 GSIASSDLTLNKLLRLYSKFGAVSYAHKLFDETPEPNSFLWTALIHG 76 >ref|XP_002280144.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] Length = 642 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +2 Query: 83 EGSVNSSDPVLNKILRFYCRFAETHYAQKVFDGVPEPNSFMWTSMIHG 226 E SV SS+ V+NK+LR Y RF T YA KVFD + +PN+++WTS+IHG Sbjct: 28 ESSVASSEFVINKLLRLYSRFGATDYAHKVFDEITQPNAYLWTSLIHG 75 >emb|CBI26355.3| unnamed protein product [Vitis vinifera] Length = 550 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +2 Query: 83 EGSVNSSDPVLNKILRFYCRFAETHYAQKVFDGVPEPNSFMWTSMIHG 226 E SV SS+ V+NK+LR Y RF T YA KVFD + +PN+++WTS+IHG Sbjct: 28 ESSVASSEFVINKLLRLYSRFGATDYAHKVFDEITQPNAYLWTSLIHG 75