BLASTX nr result
ID: Bupleurum21_contig00035224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00035224 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransf... 145 4e-33 ref|XP_002511378.1| anthranilate phosphoribosyltransferase, puta... 144 6e-33 ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransf... 143 1e-32 gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidops... 141 6e-32 ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabido... 141 6e-32 >ref|XP_002282228.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|297733759|emb|CBI15006.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 145 bits (365), Expect = 4e-33 Identities = 65/86 (75%), Positives = 79/86 (91%) Frame = -1 Query: 263 KMASALQRYGMKRAVVVHSEGLDEISPLGPGVIFDVTPEKIQQSHFDPLHFGIPRCTVED 84 KMA ALQR+GMKRA+VVHSEGLDE+SPLGPG++ DVTPEKI++ FDPL FGIPRCT++D Sbjct: 253 KMAKALQRFGMKRALVVHSEGLDEMSPLGPGLVLDVTPEKIEKFSFDPLEFGIPRCTLDD 312 Query: 83 LKGGGPDYNANILRRVLAGERGPIAD 6 L+GGGPDYNA +L+RVL+GE+G IAD Sbjct: 313 LRGGGPDYNAEVLKRVLSGEKGSIAD 338 >ref|XP_002511378.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] gi|223550493|gb|EEF51980.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] Length = 425 Score = 144 bits (364), Expect = 6e-33 Identities = 65/86 (75%), Positives = 78/86 (90%) Frame = -1 Query: 263 KMASALQRYGMKRAVVVHSEGLDEISPLGPGVIFDVTPEKIQQSHFDPLHFGIPRCTVED 84 KMA ALQR+GMKRA+VVHSEGLDE+SPLGPG++ D+TPEKI++ FDPL FGIPRCT+E Sbjct: 285 KMAKALQRFGMKRALVVHSEGLDEMSPLGPGIVLDITPEKIEKFSFDPLEFGIPRCTLES 344 Query: 83 LKGGGPDYNANILRRVLAGERGPIAD 6 L+GGGPDYNA IL+RVL+GE+G IAD Sbjct: 345 LRGGGPDYNAQILKRVLSGEKGSIAD 370 >ref|XP_002273812.1| PREDICTED: anthranilate phosphoribosyltransferase, chloroplastic [Vitis vinifera] gi|296087637|emb|CBI34893.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 143 bits (361), Expect = 1e-32 Identities = 65/87 (74%), Positives = 78/87 (89%) Frame = -1 Query: 266 SKMASALQRYGMKRAVVVHSEGLDEISPLGPGVIFDVTPEKIQQSHFDPLHFGIPRCTVE 87 +KM ALQRYGMKRA+VVHSEGLDE+SPLGPGV+ DVTP K+++ FDP +FGIPRCT+E Sbjct: 261 TKMGKALQRYGMKRALVVHSEGLDEMSPLGPGVVLDVTPGKVEKFSFDPENFGIPRCTLE 320 Query: 86 DLKGGGPDYNANILRRVLAGERGPIAD 6 DL+GG P+YNA +LRRVL+GERGPIAD Sbjct: 321 DLRGGDPEYNAKVLRRVLSGERGPIAD 347 >gb|AAB02913.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|28394222|gb|AAO42464.1| phosphorybosyl anthranilate transferase 1 [Arabidopsis thaliana] Length = 441 Score = 141 bits (355), Expect = 6e-32 Identities = 65/87 (74%), Positives = 79/87 (90%) Frame = -1 Query: 263 KMASALQRYGMKRAVVVHSEGLDEISPLGPGVIFDVTPEKIQQSHFDPLHFGIPRCTVED 84 KMA ALQR+GMKRA+VVHS GLDE+SPLG G+++DVTPEKI++ FDPL FGIPRCT+ED Sbjct: 303 KMAKALQRFGMKRALVVHSCGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLED 362 Query: 83 LKGGGPDYNANILRRVLAGERGPIADT 3 L+GGGPDYNA++LRRVL+GE G IAD+ Sbjct: 363 LRGGGPDYNADVLRRVLSGESGAIADS 389 >ref|NP_197300.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana] gi|401213|sp|Q02166.1|TRPD_ARATH RecName: Full=Anthranilate phosphoribosyltransferase, chloroplastic; Flags: Precursor gi|166792|gb|AAA32835.1| phosphoribosylanthranilate transferase [Arabidopsis thaliana] gi|9757891|dbj|BAB08398.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|15450852|gb|AAK96697.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|20259900|gb|AAM13297.1| anthranilate phosphoribosyltransferase, chloroplast precursor [Arabidopsis thaliana] gi|332005110|gb|AED92493.1| anthranilate phosphoribosyltransferase [Arabidopsis thaliana] gi|445600|prf||1909347A phosphoribosylanthranilate transferase Length = 444 Score = 141 bits (355), Expect = 6e-32 Identities = 65/87 (74%), Positives = 79/87 (90%) Frame = -1 Query: 263 KMASALQRYGMKRAVVVHSEGLDEISPLGPGVIFDVTPEKIQQSHFDPLHFGIPRCTVED 84 KMA ALQR+GMKRA+VVHS GLDE+SPLG G+++DVTPEKI++ FDPL FGIPRCT+ED Sbjct: 306 KMAKALQRFGMKRALVVHSCGLDEMSPLGGGLVYDVTPEKIEEFSFDPLDFGIPRCTLED 365 Query: 83 LKGGGPDYNANILRRVLAGERGPIADT 3 L+GGGPDYNA++LRRVL+GE G IAD+ Sbjct: 366 LRGGGPDYNADVLRRVLSGESGAIADS 392