BLASTX nr result
ID: Bupleurum21_contig00035031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00035031 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15896.3| unnamed protein product [Vitis vinifera] 119 3e-25 ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containi... 119 3e-25 ref|XP_004147925.1| PREDICTED: pentatricopeptide repeat-containi... 111 7e-23 ref|XP_002322960.1| predicted protein [Populus trichocarpa] gi|2... 110 1e-22 ref|NP_187518.1| pentatricopeptide repeat-containing protein [Ar... 109 3e-22 >emb|CBI15896.3| unnamed protein product [Vitis vinifera] Length = 650 Score = 119 bits (298), Expect = 3e-25 Identities = 56/84 (66%), Positives = 68/84 (80%) Frame = +2 Query: 65 MARLPKIITPKHLLALLKSEKSHNKALSIFDSATSHPNYTHTPDIFHHILRRLSDPNLVP 244 MA PK ++PK ++ LLKSEK+ + ALSIFDS T P Y+HTP +FHHIL+RL DP LV Sbjct: 1 MASAPKSLSPKRVIKLLKSEKNPHSALSIFDSVTRFPGYSHTPYVFHHILKRLFDPKLVA 60 Query: 245 HVTRIVELVQTQKCKCSEDVALTV 316 HV+RIVEL++TQKCKC EDVALTV Sbjct: 61 HVSRIVELIRTQKCKCPEDVALTV 84 >ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060 [Vitis vinifera] Length = 691 Score = 119 bits (298), Expect = 3e-25 Identities = 56/84 (66%), Positives = 68/84 (80%) Frame = +2 Query: 65 MARLPKIITPKHLLALLKSEKSHNKALSIFDSATSHPNYTHTPDIFHHILRRLSDPNLVP 244 MA PK ++PK ++ LLKSEK+ + ALSIFDS T P Y+HTP +FHHIL+RL DP LV Sbjct: 1 MASAPKSLSPKRVIKLLKSEKNPHSALSIFDSVTRFPGYSHTPYVFHHILKRLFDPKLVA 60 Query: 245 HVTRIVELVQTQKCKCSEDVALTV 316 HV+RIVEL++TQKCKC EDVALTV Sbjct: 61 HVSRIVELIRTQKCKCPEDVALTV 84 >ref|XP_004147925.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Cucumis sativus] gi|449516585|ref|XP_004165327.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Cucumis sativus] Length = 701 Score = 111 bits (277), Expect = 7e-23 Identities = 52/83 (62%), Positives = 64/83 (77%) Frame = +2 Query: 65 MARLPKIITPKHLLALLKSEKSHNKALSIFDSATSHPNYTHTPDIFHHILRRLSDPNLVP 244 M LPK+I+P +L LLK+EK+ N AL+IFDSA HP Y H P +FHHILRRL DP LV Sbjct: 1 MVELPKVISPTLVLKLLKAEKNPNAALAIFDSACQHPGYAHPPFVFHHILRRLMDPKLVV 60 Query: 245 HVTRIVELVQTQKCKCSEDVALT 313 HV RIV+L++ Q+C CSEDVAL+ Sbjct: 61 HVGRIVDLMRAQRCTCSEDVALS 83 >ref|XP_002322960.1| predicted protein [Populus trichocarpa] gi|222867590|gb|EEF04721.1| predicted protein [Populus trichocarpa] Length = 694 Score = 110 bits (275), Expect = 1e-22 Identities = 54/84 (64%), Positives = 65/84 (77%) Frame = +2 Query: 65 MARLPKIITPKHLLALLKSEKSHNKALSIFDSATSHPNYTHTPDIFHHILRRLSDPNLVP 244 M LPK ++ + L LLK+EKS AL++FDSA+ P YTH+P IF ILRRLSDP LV Sbjct: 1 MVELPKPLSARQLFKLLKAEKSPKSALALFDSASRQPGYTHSPHIFLLILRRLSDPKLVV 60 Query: 245 HVTRIVELVQTQKCKCSEDVALTV 316 HVTRIVEL++TQKCKC+EDV LTV Sbjct: 61 HVTRIVELIKTQKCKCTEDVVLTV 84 >ref|NP_187518.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207466|sp|Q9SS81.1|PP221_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g09060 gi|5923671|gb|AAD56322.1|AC009326_9 hypothetical protein [Arabidopsis thaliana] gi|332641194|gb|AEE74715.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 687 Score = 109 bits (272), Expect = 3e-22 Identities = 49/84 (58%), Positives = 66/84 (78%) Frame = +2 Query: 65 MARLPKIITPKHLLALLKSEKSHNKALSIFDSATSHPNYTHTPDIFHHILRRLSDPNLVP 244 M PK ++PKH+L LLKSEK+ A ++FDSAT HP Y H+ ++HHILRRLS+ +V Sbjct: 1 MVVFPKSLSPKHVLKLLKSEKNPRAAFALFDSATRHPGYAHSAVVYHHILRRLSETRMVN 60 Query: 245 HVTRIVELVQTQKCKCSEDVALTV 316 HV+RIVEL+++Q+CKC EDVAL+V Sbjct: 61 HVSRIVELIRSQECKCDEDVALSV 84