BLASTX nr result
ID: Bupleurum21_contig00034834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00034834 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB10380.1| reverse transcriptase like protein [Arabidopsis ... 43 6e-06 >emb|CAB10380.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268350|emb|CAB78643.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 1942 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 3/54 (5%) Frame = +3 Query: 171 YFDTFSSVV*NC--HHVLYSFT-HDWQIKKIDEKHGFRDGNLDEKVYML*PSGF 323 Y +T+S VV + VL+ T DW++K++D K+ F G+L E VYML P+GF Sbjct: 885 YLETYSHVVRSATVRMVLHVATVMDWEVKQMDVKNAFLHGDLTETVYMLQPAGF 938 Score = 42.7 bits (99), Expect(2) = 6e-06 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 3/54 (5%) Frame = +3 Query: 171 YFDTFSSVV*NC--HHVLYSFT-HDWQIKKIDEKHGFRDGNLDEKVYML*PSGF 323 Y +T+S VV + VL+ T DW++K++D K+ F G+L E VYML P+GF Sbjct: 1785 YLETYSHVVRSATVRMVLHVATVMDWEVKQMDVKNAFLHGDLTETVYMLQPAGF 1838 Score = 32.0 bits (71), Expect(2) = 6e-06 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 82 FRVKQKADAFLDKYKILLLEKGYNQHELINIL 177 FR K AD LDK K L+ KG++Q E I+ L Sbjct: 855 FRTKLNADGSLDKLKARLVAKGFDQEEGIDYL 886 Score = 32.0 bits (71), Expect(2) = 6e-06 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 82 FRVKQKADAFLDKYKILLLEKGYNQHELINIL 177 FR K AD LDK K L+ KG++Q E I+ L Sbjct: 1755 FRTKLNADGSLDKLKARLVAKGFDQEEGIDYL 1786