BLASTX nr result
ID: Bupleurum21_contig00034733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00034733 (417 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283562.1| PREDICTED: pentatricopeptide repeat-containi... 127 6e-39 ref|XP_003595326.1| Pentatricopeptide repeat-containing protein ... 108 1e-32 ref|NP_199192.1| pentatricopeptide repeat-containing protein [Ar... 97 4e-27 ref|XP_003535689.1| PREDICTED: pentatricopeptide repeat-containi... 125 5e-27 ref|XP_002863633.1| pentatricopeptide repeat-containing protein ... 93 6e-26 >ref|XP_002283562.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Vitis vinifera] Length = 590 Score = 127 bits (319), Expect(2) = 6e-39 Identities = 57/76 (75%), Positives = 66/76 (86%) Frame = -2 Query: 278 LFKACGSHPWLDHGRALHTHVLKFLEPTYDHFVQASLLGFYSKCGQISISRYLFDQISQP 99 LFKACGS PWL HGRALHTHVLKFLEPT D FVQA+LL +Y+KCG++ RYLF+QIS+P Sbjct: 114 LFKACGSQPWLRHGRALHTHVLKFLEPTCDPFVQAALLNYYAKCGKVGACRYLFNQISKP 173 Query: 98 DLATWNSILSAYARNA 51 DLA+WNSILSAY N+ Sbjct: 174 DLASWNSILSAYVHNS 189 Score = 58.5 bits (140), Expect(2) = 6e-39 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = -1 Query: 405 LYNTLISSILTTSHQQNTHLALSFYTRILTHTTLKPNNYTYPSL 274 LYNTLISS+ + +TH+A S Y+R+LTHTTLKPN +T+PSL Sbjct: 73 LYNTLISSLANI--KPHTHIAFSLYSRVLTHTTLKPNGFTFPSL 114 >ref|XP_003595326.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355484374|gb|AES65577.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 740 Score = 108 bits (271), Expect(2) = 1e-32 Identities = 52/93 (55%), Positives = 74/93 (79%), Gaps = 2/93 (2%) Frame = -2 Query: 278 LFKACGSHP-WLDHGRALHTHVLKFLEPTYDHFVQASLLGFYSKCGQISISRYLFDQISQ 102 LFKAC S+ W +G LHTHVLKFL+P +D+FVQASLL FY+K G++ +SRY+FD+I++ Sbjct: 256 LFKACCSNQSWFHYGPLLHTHVLKFLQPPFDNFVQASLLNFYAKYGKMCVSRYIFDRINE 315 Query: 101 PDLATWNSILSAYARNASV-NFVHGINNVDTNL 6 PDLATWN IL+AYAR++S ++ + ++ D +L Sbjct: 316 PDLATWNVILNAYARSSSYHSYSNSFDDADFSL 348 Score = 56.2 bits (134), Expect(2) = 1e-32 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = -1 Query: 405 LYNTLISSILTTSHQQNTHLALSFYTRILTHTTLKPNNYTYPSL 274 LYNTLISS++ ++Q HLA S Y +ILT+ L+PN++T+PSL Sbjct: 213 LYNTLISSLINQTNQNQIHLAFSLYNKILTNKNLQPNSFTFPSL 256 >ref|NP_199192.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75262420|sp|Q9FG85.1|PP415_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g43790 gi|10177948|dbj|BAB11307.1| unnamed protein product [Arabidopsis thaliana] gi|332007627|gb|AED95010.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 460 Score = 97.1 bits (240), Expect(2) = 4e-27 Identities = 46/81 (56%), Positives = 62/81 (76%), Gaps = 2/81 (2%) Frame = -2 Query: 278 LFKACG-SHPWLDHGRALHTHVLKFLEPT-YDHFVQASLLGFYSKCGQISISRYLFDQIS 105 LFKA G W HGRALH HVLKFLEP +D FVQA+L+GFY+ CG++ +R LF++I Sbjct: 118 LFKASGFDAQWHRHGRALHAHVLKFLEPVNHDRFVQAALVGFYANCGKLREARSLFERIR 177 Query: 104 QPDLATWNSILSAYARNASVN 42 +PDLATWN++L+AYA + ++ Sbjct: 178 EPDLATWNTLLAAYANSEEID 198 Score = 49.3 bits (116), Expect(2) = 4e-27 Identities = 24/46 (52%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -1 Query: 405 LYNTLISSILTTSHQQNTHLALSFYTRILTHTT--LKPNNYTYPSL 274 LYNTLISSI++ + THLA S Y +IL+ + ++PN +TYPSL Sbjct: 73 LYNTLISSIVSNHNSTQTHLAFSLYDQILSSRSNFVRPNEFTYPSL 118 >ref|XP_003535689.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Glycine max] Length = 591 Score = 125 bits (313), Expect = 5e-27 Identities = 58/92 (63%), Positives = 73/92 (79%), Gaps = 1/92 (1%) Frame = -2 Query: 278 LFKACGSHPWLDHGRALHTHVLKFLEPTYDHFVQASLLGFYSKCGQISISRYLFDQISQP 99 LFKAC SHPWL HG LH HVLKFL+P YD FVQ SLL FY+K G++ +SRYLFDQIS+P Sbjct: 110 LFKACASHPWLQHGPPLHAHVLKFLQPPYDPFVQNSLLNFYAKYGKLCVSRYLFDQISEP 169 Query: 98 DLATWNSILSAYARNAS-VNFVHGINNVDTNL 6 DLATWN++L+AYA++AS V++ + D +L Sbjct: 170 DLATWNTMLAAYAQSASHVSYSTSFEDADMSL 201 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/56 (51%), Positives = 37/56 (66%) Frame = -1 Query: 405 LYNTLISSILTTSHQQNTHLALSFYTRILTHTTLKPNNYTYPSL*GLWVSPLARPW 238 LYNTLISS+ T H HLA S Y ILTH TL+PN++T+PS L+ + + PW Sbjct: 69 LYNTLISSL--THHSDQIHLAFSLYNHILTHKTLQPNSFTFPS---LFKACASHPW 119 >ref|XP_002863633.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297309468|gb|EFH39892.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 460 Score = 93.2 bits (230), Expect(2) = 6e-26 Identities = 44/77 (57%), Positives = 59/77 (76%), Gaps = 2/77 (2%) Frame = -2 Query: 278 LFKACGSHP-WLDHGRALHTHVLKFLEPT-YDHFVQASLLGFYSKCGQISISRYLFDQIS 105 LFKA G W HGRALH HVLKF+EP +D FVQA+L+GFY+ CG++ +R L ++I Sbjct: 118 LFKASGFETKWHRHGRALHAHVLKFIEPVNHDRFVQAALVGFYANCGELREARSLLERIR 177 Query: 104 QPDLATWNSILSAYARN 54 +PDLATWN++L+AYA + Sbjct: 178 EPDLATWNTLLAAYANS 194 Score = 49.3 bits (116), Expect(2) = 6e-26 Identities = 24/46 (52%), Positives = 33/46 (71%), Gaps = 2/46 (4%) Frame = -1 Query: 405 LYNTLISSILTTSHQQNTHLALSFYTRILTHTT--LKPNNYTYPSL 274 LYNTLISSI++ + THLA S Y +IL+ + ++PN +TYPSL Sbjct: 73 LYNTLISSIVSNHNSTQTHLAFSLYDQILSSRSNFVRPNEFTYPSL 118