BLASTX nr result
ID: Bupleurum21_contig00034638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00034638 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509941.1| hypothetical protein RCOM_1691430 [Ricinus c... 87 1e-15 gb|AFZ84589.1| WRKY2 transcription factor, partial [Populus tric... 84 2e-14 gb|ACV92023.1| WRKY transcription factor 21 [(Populus tomentosa ... 84 2e-14 ref|XP_002304549.1| predicted protein [Populus trichocarpa] gi|2... 84 2e-14 gb|AFZ84591.1| WRKY2 transcription factor, partial [Populus alba] 83 2e-14 >ref|XP_002509941.1| hypothetical protein RCOM_1691430 [Ricinus communis] gi|223549840|gb|EEF51328.1| hypothetical protein RCOM_1691430 [Ricinus communis] Length = 338 Score = 87.4 bits (215), Expect = 1e-15 Identities = 50/102 (49%), Positives = 64/102 (62%), Gaps = 12/102 (11%) Frame = +2 Query: 8 MESACKWEKSTIASELIQGMEVAKQLKFHLNSSTSSPETQQKLLQRILSSYDNALLLLNW 187 MES WE+ T+ ELIQGME+AKQL+ HLNS+ SS ET+ L+QRILSSY+ +LL+LNW Sbjct: 1 MESGLSWEQHTLVRELIQGMELAKQLRVHLNSA-SSVETRDSLIQRILSSYEKSLLILNW 59 Query: 188 TDSTALQPQA-------PTVPESPV-----PSIEEFKDHQQD 277 + S Q A TVPESP+ P ++F D Sbjct: 60 SGSLIQQQNAGGVSVAPATVPESPISMNGSPGSDDFDGAHND 101 >gb|AFZ84589.1| WRKY2 transcription factor, partial [Populus trichocarpa] Length = 150 Score = 83.6 bits (205), Expect = 2e-14 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 4/82 (4%) Frame = +2 Query: 8 MESACKWEKSTIASELIQGMEVAKQLKFHLNSSTSSPETQQKLLQRILSSYDNALLLLNW 187 MES WE+ T+ +EL+QGME+AKQL+ HLN +TSS E++ +LLQRIL+SY+ ALL+LNW Sbjct: 1 MESGLCWEQQTLIAELVQGMELAKQLRAHLN-ATSSVESRDELLQRILASYERALLILNW 59 Query: 188 TDSTALQPQ----APTVPESPV 241 S QPQ + VPESP+ Sbjct: 60 GGSMG-QPQSVGVSAGVPESPI 80 >gb|ACV92023.1| WRKY transcription factor 21 [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 339 Score = 83.6 bits (205), Expect = 2e-14 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 4/82 (4%) Frame = +2 Query: 8 MESACKWEKSTIASELIQGMEVAKQLKFHLNSSTSSPETQQKLLQRILSSYDNALLLLNW 187 MES WE+ T+ +EL+QGME+AKQL+ HLN +TSS E++ +LLQRIL+SY+ ALL+LNW Sbjct: 1 MESGLCWEQQTLIAELVQGMELAKQLRSHLN-ATSSVESRDELLQRILASYERALLILNW 59 Query: 188 TDSTALQPQ----APTVPESPV 241 S QPQ + VPESP+ Sbjct: 60 GGSMG-QPQSVGVSAGVPESPI 80 >ref|XP_002304549.1| predicted protein [Populus trichocarpa] gi|222841981|gb|EEE79528.1| predicted protein [Populus trichocarpa] Length = 342 Score = 83.6 bits (205), Expect = 2e-14 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 4/82 (4%) Frame = +2 Query: 8 MESACKWEKSTIASELIQGMEVAKQLKFHLNSSTSSPETQQKLLQRILSSYDNALLLLNW 187 MES WE+ T+ +EL+QGME+AKQL+ HLN +TSS E++ +LLQRIL+SY+ ALL+LNW Sbjct: 1 MESGLCWEQQTLIAELVQGMELAKQLRAHLN-ATSSVESRDELLQRILASYERALLILNW 59 Query: 188 TDSTALQPQ----APTVPESPV 241 S QPQ + VPESP+ Sbjct: 60 GGSMG-QPQSVGVSAGVPESPI 80 >gb|AFZ84591.1| WRKY2 transcription factor, partial [Populus alba] Length = 150 Score = 83.2 bits (204), Expect = 2e-14 Identities = 46/82 (56%), Positives = 61/82 (74%), Gaps = 4/82 (4%) Frame = +2 Query: 8 MESACKWEKSTIASELIQGMEVAKQLKFHLNSSTSSPETQQKLLQRILSSYDNALLLLNW 187 MES WE+ T+ +EL+QGME+AKQL+ HLN +TSS E++ +LLQRIL+SY+ ALL+LNW Sbjct: 1 MESGWCWEQQTLIAELVQGMELAKQLRSHLN-ATSSVESRDELLQRILASYERALLILNW 59 Query: 188 TDSTALQPQ----APTVPESPV 241 S QPQ + VPESP+ Sbjct: 60 GGSMG-QPQSVGVSAGVPESPI 80