BLASTX nr result
ID: Bupleurum21_contig00034612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00034612 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAS76480.1| beta-galactosidase [Gossypium hirsutum] 55 6e-06 emb|CAC84109.1| putative galactosidae, partial [Gossypium hirsutum] 55 6e-06 emb|CAC13966.1| putative beta-galactosidase [Nicotiana tabacum] 55 8e-06 gb|ACC60982.1| beta-galactosidase 2 precursor [Petunia x hybrida] 55 8e-06 >gb|AAS76480.1| beta-galactosidase [Gossypium hirsutum] Length = 843 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -2 Query: 157 NSGAHMEKRWAGDDALIIKGLNTGTLDLSRNNWGHE 50 +SGA+MEKR+AG ++ I GLNTGTLD+S+N WGH+ Sbjct: 573 DSGAYMEKRFAGPRSITILGLNTGTLDISQNGWGHQ 608 >emb|CAC84109.1| putative galactosidae, partial [Gossypium hirsutum] Length = 383 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -2 Query: 157 NSGAHMEKRWAGDDALIIKGLNTGTLDLSRNNWGHE 50 +SGA+MEKR+AG ++ I GLNTGTLD+S+N WGH+ Sbjct: 238 DSGAYMEKRFAGPRSITILGLNTGTLDISQNGWGHQ 273 >emb|CAC13966.1| putative beta-galactosidase [Nicotiana tabacum] Length = 715 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -2 Query: 157 NSGAHMEKRWAGDDALIIKGLNTGTLDLSRNNWGHE 50 NSGA+MEKR+AG + ++GL GTLD+++NNWGHE Sbjct: 552 NSGAYMEKRFAGPRGITVQGLMAGTLDITQNNWGHE 587 >gb|ACC60982.1| beta-galactosidase 2 precursor [Petunia x hybrida] Length = 830 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -2 Query: 157 NSGAHMEKRWAGDDALIIKGLNTGTLDLSRNNWGHE 50 NSGA+MEKR+AG + I+GL GTLD+++NNWGHE Sbjct: 553 NSGAYMEKRFAGPRGVTIQGLMAGTLDITQNNWGHE 588