BLASTX nr result
ID: Bupleurum21_contig00034086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00034086 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274172.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-14 ref|XP_003543417.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 gb|AFK35002.1| unknown [Lotus japonicus] 74 9e-12 ref|XP_003596871.1| Pentatricopeptide repeat-containing protein ... 74 1e-11 ref|XP_003596877.1| Pentatricopeptide repeat-containing protein ... 73 2e-11 >ref|XP_002274172.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic [Vitis vinifera] Length = 313 Score = 82.0 bits (201), Expect = 5e-14 Identities = 40/64 (62%), Positives = 49/64 (76%) Frame = -1 Query: 265 YIFSRTNRQPTFLYNSLIRGYNSIKLYEQSLYVFAQMISQRKVFDPNTLPTVLKACAGLS 86 YIFS TNR+PTFLYNSLIRGY+S+ L+ QSL +F QM+ K D TLP VLK+C+GLS Sbjct: 63 YIFSLTNRRPTFLYNSLIRGYSSLFLFSQSLSIFCQMLFAHKPIDCYTLPAVLKSCSGLS 122 Query: 85 YPRM 74 R+ Sbjct: 123 ALRL 126 >ref|XP_003543417.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540-like [Glycine max] Length = 315 Score = 80.1 bits (196), Expect = 2e-13 Identities = 39/63 (61%), Positives = 49/63 (77%) Frame = -1 Query: 262 IFSRTNRQPTFLYNSLIRGYNSIKLYEQSLYVFAQMISQRKVFDPNTLPTVLKACAGLSY 83 +FS T RQPTFL+NSLIR Y+S+ L+ QSL +F QM+ RK FD +TLP VLK+CAGLS Sbjct: 65 LFSFTIRQPTFLFNSLIRAYSSLNLFSQSLCIFRQMLLARKPFDRHTLPVVLKSCAGLSA 124 Query: 82 PRM 74 R+ Sbjct: 125 LRL 127 >gb|AFK35002.1| unknown [Lotus japonicus] Length = 219 Score = 74.3 bits (181), Expect = 9e-12 Identities = 37/63 (58%), Positives = 46/63 (73%) Frame = -1 Query: 262 IFSRTNRQPTFLYNSLIRGYNSIKLYEQSLYVFAQMISQRKVFDPNTLPTVLKACAGLSY 83 +FS TNRQPTFL+NSLIR S+ L+ QSL +F QM+ K FD TLP VLK+CAGL+ Sbjct: 89 LFSFTNRQPTFLFNSLIRANASLNLFSQSLSLFRQMLRSWKPFDRQTLPVVLKSCAGLTA 148 Query: 82 PRM 74 R+ Sbjct: 149 LRL 151 >ref|XP_003596871.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|124359886|gb|ABD32760.2| Tetratricopeptide-like helical [Medicago truncatula] gi|355485919|gb|AES67122.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 316 Score = 73.9 bits (180), Expect = 1e-11 Identities = 36/63 (57%), Positives = 48/63 (76%) Frame = -1 Query: 262 IFSRTNRQPTFLYNSLIRGYNSIKLYEQSLYVFAQMISQRKVFDPNTLPTVLKACAGLSY 83 +FS TNR+PTFLYNSLIR Y S+ L++++L +F +M K FD +TLP VLK+CAGLS Sbjct: 65 LFSFTNRKPTFLYNSLIRAYLSLNLFKETLSIFREMRLSYKPFDCHTLPLVLKSCAGLSA 124 Query: 82 PRM 74 R+ Sbjct: 125 LRL 127 >ref|XP_003596877.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|87240912|gb|ABD32770.1| Tetratricopeptide-like helical [Medicago truncatula] gi|355485925|gb|AES67128.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 316 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/63 (57%), Positives = 48/63 (76%) Frame = -1 Query: 262 IFSRTNRQPTFLYNSLIRGYNSIKLYEQSLYVFAQMISQRKVFDPNTLPTVLKACAGLSY 83 +FS TNR+PTFLYNSLIR Y S+ L++++L +F +M K FD +TLP VLK+CAGLS Sbjct: 65 LFSFTNRKPTFLYNSLIRAYLSLNLFKETLSLFREMRLSYKPFDCHTLPLVLKSCAGLSA 124 Query: 82 PRM 74 R+ Sbjct: 125 LRL 127