BLASTX nr result
ID: Bupleurum21_contig00034010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00034010 (724 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB02389.1| glucan synthase-like protein [Arabidopsis thaliana] 57 4e-06 ref|NP_001189893.1| callose synthase [Arabidopsis thaliana] gi|3... 57 4e-06 ref|NP_188075.2| callose synthase [Arabidopsis thaliana] gi|1890... 57 4e-06 >dbj|BAB02389.1| glucan synthase-like protein [Arabidopsis thaliana] Length = 1972 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 61 RFHAFEVAHNLDRDSSRRGLRQFKTSLLQRLE 156 RFHAFE+AH++DR+S+ RG+RQFKTSLLQRLE Sbjct: 86 RFHAFEIAHHMDRNSTGRGVRQFKTSLLQRLE 117 >ref|NP_001189893.1| callose synthase [Arabidopsis thaliana] gi|332642019|gb|AEE75540.1| callose synthase [Arabidopsis thaliana] Length = 1950 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 61 RFHAFEVAHNLDRDSSRRGLRQFKTSLLQRLE 156 RFHAFE+AH++DR+S+ RG+RQFKTSLLQRLE Sbjct: 86 RFHAFEIAHHMDRNSTGRGVRQFKTSLLQRLE 117 >ref|NP_188075.2| callose synthase [Arabidopsis thaliana] gi|189081842|sp|Q9LUD7.2|CALS8_ARATH RecName: Full=Putative callose synthase 8; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 4 gi|332642018|gb|AEE75539.1| callose synthase [Arabidopsis thaliana] Length = 1976 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 61 RFHAFEVAHNLDRDSSRRGLRQFKTSLLQRLE 156 RFHAFE+AH++DR+S+ RG+RQFKTSLLQRLE Sbjct: 86 RFHAFEIAHHMDRNSTGRGVRQFKTSLLQRLE 117