BLASTX nr result
ID: Bupleurum21_contig00032987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032987 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527915.1| anthranilate phosphoribosyltransferase, puta... 55 6e-06 >ref|XP_002527915.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] gi|223532690|gb|EEF34472.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] Length = 589 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = +3 Query: 135 LKTSREFKTAGLC*LSPKGELKDEEKVSKAQLGAFFAAMTIRTN 266 L + FK S +GELKDEEKVSKAQLGAFFAAMTIR N Sbjct: 107 LNEDQAFKVLDTILRSARGELKDEEKVSKAQLGAFFAAMTIRAN 150