BLASTX nr result
ID: Bupleurum21_contig00032907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032907 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACE79506.1| NBS-coding resistance gene analog [Nicotiana taba... 86 4e-15 gb|ACE79505.1| NBS-coding resistance gene analog [Nicotiana taba... 86 4e-15 gb|ACE79504.1| NBS-coding resistance gene analog [Nicotiana taba... 86 4e-15 gb|ACE79503.1| NBS-coding resistance gene analog [Nicotiana taba... 86 4e-15 gb|ACE79502.1| NBS-coding resistance gene analog [Nicotiana taba... 86 4e-15 >gb|ACE79506.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 279 Score = 85.5 bits (210), Expect = 4e-15 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 4/91 (4%) Frame = +1 Query: 7 PPHHLRFLTDGESWKLLERKVFGRESCPSELKDLGKLILVKCHGLPLAIAVVAGLLYKKD 186 PPHH+ FL+ +SWKLL KVFG E CP +L+++GK I +C GL L++ V+AGLL K + Sbjct: 173 PPHHMPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQCQGLALSVVVIAGLLSKIN 232 Query: 187 KAH--WKRIADSIGASNG--THQLLDILAQS 267 + + W++IAD++ + G + Q L ILA S Sbjct: 233 RTYDDWQQIADNVNSHIGSTSQQCLAILALS 263 >gb|ACE79505.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 302 Score = 85.5 bits (210), Expect = 4e-15 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 4/91 (4%) Frame = +1 Query: 7 PPHHLRFLTDGESWKLLERKVFGRESCPSELKDLGKLILVKCHGLPLAIAVVAGLLYKKD 186 PPHH+ FL+ +SWKLL KVFG E CP +L+++GK I +C GL L++ V+AGLL K + Sbjct: 194 PPHHMPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQCQGLALSVVVIAGLLSKIN 253 Query: 187 KAH--WKRIADSIGASNG--THQLLDILAQS 267 + + W++IAD++ + G + Q L ILA S Sbjct: 254 RTYDDWQQIADNVNSHIGSTSQQCLAILALS 284 >gb|ACE79504.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 274 Score = 85.5 bits (210), Expect = 4e-15 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 4/91 (4%) Frame = +1 Query: 7 PPHHLRFLTDGESWKLLERKVFGRESCPSELKDLGKLILVKCHGLPLAIAVVAGLLYKKD 186 PPHH+ FL+ +SWKLL KVFG E CP +L+++GK I +C GL L++ V+AGLL K + Sbjct: 156 PPHHMPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQCQGLALSVVVIAGLLSKIN 215 Query: 187 KAH--WKRIADSIGASNG--THQLLDILAQS 267 + + W++IAD++ + G + Q L ILA S Sbjct: 216 RTYDDWQQIADNVNSHIGSTSQQCLAILALS 246 >gb|ACE79503.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 285 Score = 85.5 bits (210), Expect = 4e-15 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 4/91 (4%) Frame = +1 Query: 7 PPHHLRFLTDGESWKLLERKVFGRESCPSELKDLGKLILVKCHGLPLAIAVVAGLLYKKD 186 PPHH+ FL+ +SWKLL KVFG E CP +L+++GK I +C GL L++ V+AGLL K + Sbjct: 173 PPHHMPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQCQGLALSVVVIAGLLSKIN 232 Query: 187 KAH--WKRIADSIGASNG--THQLLDILAQS 267 + + W++IAD++ + G + Q L ILA S Sbjct: 233 RTYDDWQQIADNVNSHIGSTSQQCLAILALS 263 >gb|ACE79502.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 282 Score = 85.5 bits (210), Expect = 4e-15 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 4/91 (4%) Frame = +1 Query: 7 PPHHLRFLTDGESWKLLERKVFGRESCPSELKDLGKLILVKCHGLPLAIAVVAGLLYKKD 186 PPHH+ FL+ +SWKLL KVFG E CP +L+++GK I +C GL L++ V+AGLL K + Sbjct: 174 PPHHMPFLSLEDSWKLLSLKVFGNEDCPPQLEEVGKQIAKQCQGLALSVVVIAGLLSKIN 233 Query: 187 KAH--WKRIADSIGASNG--THQLLDILAQS 267 + + W++IAD++ + G + Q L ILA S Sbjct: 234 RTYDDWQQIADNVNSHIGSTSQQCLAILALS 264