BLASTX nr result
ID: Bupleurum21_contig00032803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032803 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002459536.1| hypothetical protein SORBIDRAFT_02g006250 [S... 58 7e-07 ref|XP_002459535.1| hypothetical protein SORBIDRAFT_02g006240 [S... 58 9e-07 >ref|XP_002459536.1| hypothetical protein SORBIDRAFT_02g006250 [Sorghum bicolor] gi|241922913|gb|EER96057.1| hypothetical protein SORBIDRAFT_02g006250 [Sorghum bicolor] Length = 1036 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = +1 Query: 1 ADPRIVVEDAWSNTNQSYSRVALEVCLSSIFEVGILCSVETPKERMEISVAIKQLHAARD 180 AD + + D SN N + + CLS+I ++G+LCS + P ER+ IS A ++HA RD Sbjct: 964 ADSNLWLHDEASNNNDTRHIMRTRKCLSAIIQLGVLCSKQLPSERLSISDATAEMHAIRD 1023 Query: 181 KFLSQQ 198 K++S Q Sbjct: 1024 KYISAQ 1029 >ref|XP_002459535.1| hypothetical protein SORBIDRAFT_02g006240 [Sorghum bicolor] gi|241922912|gb|EER96056.1| hypothetical protein SORBIDRAFT_02g006240 [Sorghum bicolor] Length = 1047 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/66 (40%), Positives = 41/66 (62%) Frame = +1 Query: 1 ADPRIVVEDAWSNTNQSYSRVALEVCLSSIFEVGILCSVETPKERMEISVAIKQLHAARD 180 AD + + D SN+N + CLS+I ++G+LCS + P ER+ IS A ++HA RD Sbjct: 982 ADSNLWLHDEASNSNDTRHITRSRKCLSAIIQLGVLCSKQLPSERLSISDATAEMHAIRD 1041 Query: 181 KFLSQQ 198 K++S Q Sbjct: 1042 KYISAQ 1047