BLASTX nr result
ID: Bupleurum21_contig00032663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032663 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003523079.1| PREDICTED: probable inactive poly [ADP-ribos... 48 4e-07 gb|AAC18815.1| F17O7.2 [Arabidopsis thaliana] 58 7e-07 ref|NP_177201.1| SRO3-like protein [Arabidopsis thaliana] gi|338... 58 7e-07 ref|XP_002888780.1| hypothetical protein ARALYDRAFT_476164 [Arab... 58 9e-07 ref|XP_002525374.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_003523079.1| PREDICTED: probable inactive poly [ADP-ribose] polymerase SRO5-like [Glycine max] Length = 330 Score = 48.1 bits (113), Expect(2) = 4e-07 Identities = 18/44 (40%), Positives = 30/44 (68%) Frame = -2 Query: 440 SGVDNLEEPTKYIVWTCYMNSHILPCFVITYKAPLLTGKKNYKE 309 SGVD+ PTKYI+W+ MN+H+LP +V++++ G + +E Sbjct: 196 SGVDSFSGPTKYIIWSNRMNTHVLPAYVVSFRVSSFKGMEKSEE 239 Score = 30.8 bits (68), Expect(2) = 4e-07 Identities = 14/30 (46%), Positives = 22/30 (73%) Frame = -3 Query: 325 KKITKKQLITKVRQIAGDNILKSVIELSRN 236 KKI + +LI +VR+IAGD +L + I+ R+ Sbjct: 280 KKILRHELIQRVREIAGDKLLVAAIKSYRD 309 >gb|AAC18815.1| F17O7.2 [Arabidopsis thaliana] Length = 327 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -2 Query: 440 SGVDNLEEPTKYIVWTCYMNSHILPCFVITYKAPLLTG 327 SGVDNLE P KY++W+C MNS+ILP +++++K+ LL G Sbjct: 198 SGVDNLENPRKYVIWSCNMNSYILPTYIVSFKSHLLRG 235 >ref|NP_177201.1| SRO3-like protein [Arabidopsis thaliana] gi|338819582|sp|O64592.2|SRO3_ARATH RecName: Full=Probable inactive poly [ADP-ribose] polymerase SRO3; AltName: Full=Protein SIMILAR TO RCD ONE 3 gi|332196941|gb|AEE35062.1| SRO3-like protein [Arabidopsis thaliana] Length = 305 Score = 58.2 bits (139), Expect = 7e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -2 Query: 440 SGVDNLEEPTKYIVWTCYMNSHILPCFVITYKAPLLTG 327 SGVDNLE P KY++W+C MNS+ILP +++++K+ LL G Sbjct: 198 SGVDNLENPRKYVIWSCNMNSYILPTYIVSFKSHLLRG 235 >ref|XP_002888780.1| hypothetical protein ARALYDRAFT_476164 [Arabidopsis lyrata subsp. lyrata] gi|297334621|gb|EFH65039.1| hypothetical protein ARALYDRAFT_476164 [Arabidopsis lyrata subsp. lyrata] Length = 304 Score = 57.8 bits (138), Expect = 9e-07 Identities = 22/38 (57%), Positives = 32/38 (84%) Frame = -2 Query: 440 SGVDNLEEPTKYIVWTCYMNSHILPCFVITYKAPLLTG 327 SGVDNLE P KY++W+ MNS+ILP +++++K+PLL G Sbjct: 197 SGVDNLENPRKYVIWSSNMNSYILPTYIVSFKSPLLRG 234 >ref|XP_002525374.1| conserved hypothetical protein [Ricinus communis] gi|223535337|gb|EEF37012.1| conserved hypothetical protein [Ricinus communis] Length = 327 Score = 57.0 bits (136), Expect = 2e-06 Identities = 22/40 (55%), Positives = 30/40 (75%) Frame = -2 Query: 440 SGVDNLEEPTKYIVWTCYMNSHILPCFVITYKAPLLTGKK 321 SGVDNL +P +YI+W +MNSHI P ++I++KAP G K Sbjct: 210 SGVDNLHKPRRYIIWNAFMNSHIFPTYIISFKAPSFNGIK 249