BLASTX nr result
ID: Bupleurum21_contig00032618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Bupleurum21_contig00032618 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525921.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >ref|XP_002525921.1| conserved hypothetical protein [Ricinus communis] gi|223534750|gb|EEF36441.1| conserved hypothetical protein [Ricinus communis] Length = 191 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = -3 Query: 214 NWVRPLNDEVKITFDASVF-TESSYGVGLLARNSTGAVVQGRSDLFQGNVRPGFAEAMAV 38 +W +P N+ +KI DA +F ++ G G++ RN +V R+ + G AEAMAV Sbjct: 52 SWRKPHNEYLKINEDAGIFQAQNRTGYGMVVRNHAANLVAARALIIHGVYEANLAEAMAV 111 Query: 37 KEALSWCKTKNW 2 +EALSW K NW Sbjct: 112 REALSWIKHMNW 123